KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0465Help
Entry
DAMO_0465         CDS       T02155                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Brite
Enzymes [BR:mox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     DAMO_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(404837..405787)
Genome map
AA seq 316 aa AA seqDB search
MSRRLTTQSGPLDEMVGRQPTDLAFHTDSRTLVYLIHGVTGTPVEMGYLGRRLARHGWDV
YATTLPGHCTRLRDLMRTSEEDWIAHVKAQLAFVRERYDRLYVAGLSAGGLLALDSSLTV
NVDGLGVFSPTFFYDGWKTPWTRALLPFVMEVAPLGYLLFHQDGPPFGIKERRLQAHKRA
SYGSVSLLRRWIMGLWTRMTHAADQAISAPLAATMGYPIFPLKTLTNIDRLSTLVRRRLG
EVTAPTLILQAREDDITGPRNGELVHNGIASIRKRLILLDDCYHVITVDKQKKAVADHLI
EFFGRQTSRSETHQLA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagccgacgactgaccacgcagtctggtcctcttgatgagatggtcggccgccaaccg
accgacctcgccttccacaccgactcacgtaccttggtatatctgattcacggtgtcaca
gggacaccggtcgagatgggctaccttggacggcggttggcgcgccacggatgggacgtc
tatgccacaaccctcccgggccactgtacgcggctcagggacctgatgagaacgtccgag
gaggactggatcgcgcacgtgaaggcgcaacttgccttcgtacgcgaacggtacgaccgc
ctctatgtggccggcctgagcgcgggaggactcctggcgttggactcctcactgaccgtg
aatgttgatggacttggagtcttctcgcccacctttttttatgatgggtggaagacgcct
tggaccagagcactcttgccctttgttatggaggtggctcctttgggctatctcctcttc
caccaggatggtccaccctttggaattaaggagagacggcttcaggcccacaagcgggcg
tcgtatggttccgtttcgctcctgcgtcgatggatcatgggtttgtggactcgcatgacc
catgctgccgaccaggcgatcagtgcccctttggcagccacgatggggtatccgatcttt
ccgttgaagaccttgaccaatatagatcggctctccacgctcgtccgtcgtcgcttgggt
gaggtgacggcgcccaccttgatcctccaggctcgcgaagacgacatcaccggccctcgt
aatggcgaactagtgcacaacggcatcgcttcaatacggaagcgcctgatcttactcgat
gactgctaccatgtgatcacggtggataagcagaaaaaagccgttgccgaccacctgatt
gagttctttggtcgccagacctccagatcggagacccatcaactcgcatag

  All links  
No link information was found.   
DBGET integrated database retrieval system