KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0537Help
Entry
DAMO_0537         CDS       T02155                                 

Gene name
tufB
Definition
Elongation factor Tu (EF-Tu)
Orthology
K02358  
elongation factor Tu
Organism
mox  Candidatus Methylomirabilis oxyfera
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
474826..476028
Genome map
AA seq 400 aa AA seqDB search
MAKAKFERTKEHMNIGTIGHIDHGKTTLTAAITKVLHAANAKVAFVPFDQIDKAPEEKER
GITINIAHVEYETAKRHYAHVDCPGHADYIKNMITGAAQMDGAILVVAASEGPMPQTREH
ILLARQVNVPNLVVFLNKVDLVDDPELLELVELEVRELLTAYNFPGDDIPFVRGSALKAL
ETGSGDRSNPASTPIFELMDAVDAYFPAPVRVLDKPFLMPIEDVFSISGRGTVVTGRVER
GIIKVSDEVELVGIRDTQRTVVTGVEMFRKLLDQGQAGDNVGLLLRGTKREEVERGQVVA
KPGSIPPHTRFKAEAYILTKEEGGRHTPFFNGYRPQFYFRTTDVTGVCTLPAGTEMVMPG
DNVSLAVELIQPIAMEKELRFAIREGGRTVGAGVVSEVLE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggcgaagttcgagcggacgaaagaacatatgaacatcgggaccatcgggcac
atcgaccacggcaagaccaccctgaccgcggcgatcacgaaggtcctccatgcggcgaat
gcgaaggtcgccttcgttcccttcgaccagatcgacaaggcgccggaggagaaggagcgg
gggatcactatcaacatcgcccacgtcgagtatgagacggccaagcggcactacgcccat
gtcgactgccccggccacgccgactacatcaagaacatgatcaccggcgcggctcagatg
gacggggcgatcctggtcgtcgccgcctctgagggcccaatgccccagacccgcgagcac
atcctcctggcccgacaggtcaacgtccccaacctggtcgtctttctgaacaaggtcgac
ctggtggacgatcccgaactgctcgagctggtcgaactggaggtccgcgagctgctcacc
gcctacaacttcccgggcgacgacatcccctttgtccgcggcagcgcgctcaaagcgctg
gagaccggcagcggtgaccgcagcaacccggcgtccacaccgatctttgagctcatggac
gctgtcgacgcctacttccccgcccccgtccgcgtgctggataagccgttcctcatgccg
atcgaggacgtcttctcgatctccggacgcgggaccgtcgtcaccggccgcgtcgagcgc
ggcatcatcaaggtcagcgacgaggtggagctcgtcggcatccgagatacccagcggacc
gtcgtcaccggggtcgagatgttccggaagctcctcgatcagggccaggccggcgacaac
gtcgggctgctcctgcgagggaccaagcgcgaggaagtagagcgcggccaggtggtggcc
aagcccggctccatccccccccatacgcgctttaaggccgaagcctacatcctcaccaag
gaagagggcggtcgccatacccccttcttcaacggctatcggccccagttctacttccgg
acgactgatgtgacgggggtctgcacgctccccgccgggaccgagatggtcatgccgggc
gacaacgtgagcctcgcggtcgaactgattcagccgatcgccatggagaaggagttgcgc
ttcgcgatccgcgagggcggccgcactgtgggggccggcgtggtgagcgaggtgttggag
tag

DBGET integrated database retrieval system