KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0588Help
Entry
DAMO_0588         CDS       T02155                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00260  Glycine, serine and threonine metabolism
mox00750  Vitamin B6 metabolism
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
mox01120  Microbial metabolism in diverse environments
mox01230  Biosynthesis of amino acids
Module
mox_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DAMO_0588 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DAMO_0588 (thrC)
Enzymes [BR:mox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DAMO_0588 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CBE67663
UniProt: D5MKL6
Position
512576..513640
Genome map
AA seq 354 aa AA seqDB search
MKTMSWKGIIEQYRAFLPVTDRTPVVTLGEGNTPLVRAERLRAAIGIEAEVYLKYEGLNP
TGSFKDRGMTLAITKAAEEGARAVICASTGNTSASAAAYATRAGLRAYVLIPEGKIALGK
LAQAMIHGAQVLQIEGNFDQALQIVRRVAADLPIVLVNSVNPYRIEGQKSGAFEVCDRLG
RSPDYHFIPVGNGGNITAYWKGYQEYLKAGRISSLPKMMGWQAEGAAPIVLGRVVEQPET
IATAIRIGNPASWNGAVAASAESGGQIDMVSDSEIIDAYRLLASMEGVFCELASASSVAG
LIKYCRSNRLPKDAVVVCVLTGHGLKEPDAAIRLSQQPVTVKADPEAVLKLLSV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccatgagttggaaggggatcatcgaacagtatcgggcgtttttgcctgtgacg
gaccggacgccggtcgtcacactgggcgagggcaatacgccgctggtgcgcgctgaacgg
ctccgggcggcgatcgggattgaggcggaggtctatctgaagtacgaggggctcaacccg
accggctcgtttaaggatcgggggatgaccctcgccattaccaaggcggcagaggagggt
gcgagagctgtcatctgcgcctcgaccggcaatacctcggcctccgccgcagcgtacgca
acgcgggcggggctgcgagcctatgtgcttatcccggagggaaagatcgcgctgggtaag
ctggcgcaggcgatgattcatggcgcgcaggtgctgcagattgaaggcaacttcgaccag
gccctgcagatcgtcaggcgcgtggctgccgatctgccgattgtattggtcaactcggtc
aacccatatcggatcgagggtcagaagagcggcgcctttgaggtctgcgaccggctcggc
cggagtccggactaccactttattccggtaggcaatgggggcaatattaccgcctactgg
aaggggtatcaggaatatctgaaggccggacggatcagctcgctgccaaagatgatggga
tggcaggcagaaggcgcggcgccgatcgtcctgggaagggtggtcgaacaaccggagacg
atcgcgacggccattcggatcgggaaccctgcaagctggaatggggcggtggcggcctcg
gccgagtccggcggacagattgacatggtctccgacagtgagatcatcgacgcctaccgc
ctcctggcttccatggagggggtcttttgtgagctggcctcagcgtcgtccgtggccggc
ctcatcaaatactgccggtcgaatcgcctgccgaaggatgcggtggtggtgtgcgtgctg
acgggacatggcctgaaagagcctgatgctgccatccgtctttcgcagcaacctgtaaca
gtgaaggccgatcctgaggctgtgctgaagctcctgtcggtctag

DBGET integrated database retrieval system