KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0695Help
Entry
DAMO_0695         CDS       T02155                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DAMO_0695
   01230 Biosynthesis of amino acids
    DAMO_0695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAMO_0695
   00030 Pentose phosphate pathway
    DAMO_0695
   00051 Fructose and mannose metabolism
    DAMO_0695
   00052 Galactose metabolism
    DAMO_0695
  Energy metabolism
   00680 Methane metabolism
    DAMO_0695
Enzymes [BR:mox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DAMO_0695
Protein phosphatases and associated proteins [BR:mox01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DAMO_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(588574..589824)
Genome map
AA seq 416 aa AA seqDB search
MKTLAMLVGGGPAPGINGVIAAATIEARNHGVRVLGFYDGFKWLARGDTGHVIELEIDGI
SRIHFEGGSILRTSRTNPTKSQETLRNTIEALEKLEVSGLLTIGGDDTAFASYRLSDAVK
GRIAVAHVPKTIDNDLPLPQEVATFGFTTACNLGKEIVQNLMDDAETTDRWFFITVMGRR
AGHLALGIGGAAGATLTVIGEEFSEPRIPLQTLVDILEGAVIKRRTSGKGHGVAILSEGL
ADKLDPAEFGSVEQDGYGNVRLSELVLGRVLKERVAESLRARGIDVTIVAKDIGYELRCA
PPGALDIQYCRSLGYWATRFLLDGQTEAMVTIQGGKMVPIPFQKMLDHRTGKIRVRYVDI
DSESYQTLRAYMIRLEFQDFETSGQIEALARDGHLEPTAFTNRFRYLGERTKGSSQ
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgcttgccatgttggtcggaggcggccccgcgcctggtattaacggcgtgatt
gcggcggcaaccatcgaggcccgcaaccatggggtacgcgtcctcggcttctacgatggg
ttcaagtggcttgcgcgaggcgataccggccacgtgatagagctcgaaatcgacgggata
tcccggatccatttcgagggcgggtccatccttcggacgtccaggacgaacccgaccaaa
tcccaggagacgctcagaaatacgatcgaggcgctggagaaactggaggtctcaggcctg
ttgacgatcgggggcgacgacactgccttcgcgtcgtatcgactgtcggacgcggtgaag
ggtcggatcgctgtcgcgcatgtaccgaaaacgatcgataacgatctcccgcttccgcag
gaagtcgcgacgtttggttttaccacggcctgcaatctgggcaaggaaatcgtccagaat
ctgatggacgatgcagaaacaacggaccgatggtttttcatcacggtgatggggcgacgg
gccggccatctggcgcttgggattggaggcgccgccggcgccacactcacggtgatcgga
gaggaattttcggagccgaggatccctcttcagacactggttgatatcctggaaggagca
gtcatcaagcgacgcacgtcagggaagggacatggcgtggccattctgagcgaagggctg
gccgataaactggatcctgccgagttcggctcggtagaacaggacggttatgggaatgtc
cggctttcggagcttgtgctcggacgagtactgaaagagcgagttgccgaaagtcttcgg
gcgagaggcatcgatgtcacgatcgtggcgaaagatatcggttatgaactccgctgtgct
cccccgggtgcgttggatatccagtattgtcgcagtcttggctattgggcgacccgtttc
ctgttggacggtcagacggaagccatggtgactatccagggagggaagatggtcccgatc
ccgtttcagaagatgttggatcatcggacagggaagatccgcgtccgttacgttgatatc
gactccgagtcgtatcagacgcttcgggcctatatgattcgcctggagttccaggatttt
gagacgtcggggcagatcgaggcgctggcgcgtgacggccatctggagccgacggcattt
acgaaccgattcaggtatctcggcgaacgcacgaaagggtcatcgcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system