KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0746Help
Entry
DAMO_0746         CDS       T02155                                 

Gene name
sucB
Definition
(RefSeq) 2-oxoglutarate dehydrogenase complex E2 component (EC:2.3.1.61)
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DAMO_0746 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DAMO_0746 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    DAMO_0746 (sucB)
Enzymes [BR:mox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DAMO_0746 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(628583..629794)
Genome map
AA seq 403 aa AA seqDB search
MLIEVVMPQMGESVAEGTVVTWLKKVGDSIAKDEPLVAISTDKVDVEIPAPSAGVLSQIV
VQEGVTASVGAVLAYIGEASHAGAVSPDRSVVERQDGVQTAAPAVEAAAPATRWYSPAVL
DLAQEHDVDLTQVRGTGADGRVTRKDLLDFIAQRSETVAASPRVSPELPAPLIEDRILPI
SPMRKAIAEHMIRSKRTAAHVTQIHEVDMTAIDRYRQAHHSAFLKETGTALTFLPFVVKA
VADGLRAYPLINASFTHKGIIVKHAINIGIAVALEEGLIVPVLREADKKSFLTLTKQLTD
LAVRARDKRLSLEEVHEGTFTVNNFGALGTMIGTPIIVQPQAAILGLGRVVKRPVVIDDA
IVIRSMAYLCLSYDHRLIDGAYASAFLNHVRATLEGFDFSVIR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctcattgaagtggtcatgccccagatgggcgaaagcgtcgctgaggggacggtcgtc
acctggctcaagaaggtcggcgactcgatcgccaaagatgagccgctggtggctatctct
acggataaggtggacgtcgagattcccgccccttccgccggggtattgtctcagatcgtc
gtccaggaaggggtgacagcgtcggtcggagccgtgctggcctatatcggcgaggcttct
cacgccggcgcggtctcgccggacaggtcggtagtggagcggcaggatggggttcagacc
gctgcaccagcagtagaggccgcagcgccggcaacgcgctggtactcacccgccgtcctc
gacctggcacaggaacacgacgtcgatctcacccaagtaagaggcaccggcgcagatgga
cgtgtgacgaggaaggatctgctggacttcatcgcgcagcggtcagagacggtcgccgcg
tcacctcgcgtatcccctgaactccccgccccccttatcgaagaccggatcctcccgatc
agccccatgcgaaaggccatcgccgagcatatgatccggagcaagcggaccgctgctcat
gtcacgcagatccacgaagtcgatatgacggctatcgaccgctaccggcaggcacaccat
agcgccttcctcaaggagaccgggaccgcgcttacctttctcccctttgtcgtaaaggcc
gtcgcggatggcctgcgggcctatccgctcatcaacgcctccttcactcataagggaatt
attgtcaagcacgcaatcaatatcgggatcgccgtggccctggaggaaggtcttattgtc
ccggtgctgcgagaggccgataagaaaagctttctgaccctgacgaaacagttgactgat
ctggccgtccgggctcgcgacaaacggctcagcctggaggaggtccacgaagggaccttc
acggtcaacaacttcggcgcgctggggactatgattggaacgccgatcattgttcaaccg
caggcagccatcctgggcctgggcagggtcgtgaagcggccggtcgtaattgacgatgcg
atcgtcatccgttcgatggcctacctctgtctctcctacgatcatcgcctcatcgacggc
gcctacgccagcgccttcctcaaccatgtgcgggctacgctcgagggatttgatttctcc
gtcattcgttag

DBGET integrated database retrieval system