KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0746Help
Entry
DAMO_0746         CDS       T02155                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase complex E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mox01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mox00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mox00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(628583..629794)
Genome map
AA seq 403 aa AA seqDB search
MLIEVVMPQMGESVAEGTVVTWLKKVGDSIAKDEPLVAISTDKVDVEIPAPSAGVLSQIV
VQEGVTASVGAVLAYIGEASHAGAVSPDRSVVERQDGVQTAAPAVEAAAPATRWYSPAVL
DLAQEHDVDLTQVRGTGADGRVTRKDLLDFIAQRSETVAASPRVSPELPAPLIEDRILPI
SPMRKAIAEHMIRSKRTAAHVTQIHEVDMTAIDRYRQAHHSAFLKETGTALTFLPFVVKA
VADGLRAYPLINASFTHKGIIVKHAINIGIAVALEEGLIVPVLREADKKSFLTLTKQLTD
LAVRARDKRLSLEEVHEGTFTVNNFGALGTMIGTPIIVQPQAAILGLGRVVKRPVVIDDA
IVIRSMAYLCLSYDHRLIDGAYASAFLNHVRATLEGFDFSVIR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgctcattgaagtggtcatgccccagatgggcgaaagcgtcgctgaggggacggtcgtc
acctggctcaagaaggtcggcgactcgatcgccaaagatgagccgctggtggctatctct
acggataaggtggacgtcgagattcccgccccttccgccggggtattgtctcagatcgtc
gtccaggaaggggtgacagcgtcggtcggagccgtgctggcctatatcggcgaggcttct
cacgccggcgcggtctcgccggacaggtcggtagtggagcggcaggatggggttcagacc
gctgcaccagcagtagaggccgcagcgccggcaacgcgctggtactcacccgccgtcctc
gacctggcacaggaacacgacgtcgatctcacccaagtaagaggcaccggcgcagatgga
cgtgtgacgaggaaggatctgctggacttcatcgcgcagcggtcagagacggtcgccgcg
tcacctcgcgtatcccctgaactccccgccccccttatcgaagaccggatcctcccgatc
agccccatgcgaaaggccatcgccgagcatatgatccggagcaagcggaccgctgctcat
gtcacgcagatccacgaagtcgatatgacggctatcgaccgctaccggcaggcacaccat
agcgccttcctcaaggagaccgggaccgcgcttacctttctcccctttgtcgtaaaggcc
gtcgcggatggcctgcgggcctatccgctcatcaacgcctccttcactcataagggaatt
attgtcaagcacgcaatcaatatcgggatcgccgtggccctggaggaaggtcttattgtc
ccggtgctgcgagaggccgataagaaaagctttctgaccctgacgaaacagttgactgat
ctggccgtccgggctcgcgacaaacggctcagcctggaggaggtccacgaagggaccttc
acggtcaacaacttcggcgcgctggggactatgattggaacgccgatcattgttcaaccg
caggcagccatcctgggcctgggcagggtcgtgaagcggccggtcgtaattgacgatgcg
atcgtcatccgttcgatggcctacctctgtctctcctacgatcatcgcctcatcgacggc
gcctacgccagcgccttcctcaaccatgtgcgggctacgctcgagggatttgatttctcc
gtcattcgttag

DBGET integrated database retrieval system