KEGG   Candidatus Methylomirabilis oxyfera: DAMO_0909Help
Entry
DAMO_0909         CDS       T02155                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00521  Streptomycin biosynthesis
mox00523  Polyketide sugar unit biosynthesis
mox01130  Biosynthesis of antibiotics
Module
mox_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DAMO_0909
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DAMO_0909
Enzymes [BR:mox01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DAMO_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_2 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: CBE67970
UniProt: D5MM84
Position
772953..773477
Genome map
AA seq 174 aa AA seqDB search
MDEAFKKDRQTVTPEGKSVLPLIHDVRIRSAVTHPDERGTICEIYNSAWDFSEAPVVYVY
QVTVRPQRIKGWVVHYQQDDRVFVSQGVLKIVMYDPRKESPTHGMLNELCISEHNRGLLF
IPRGVYHALQNVGTTDALFINMPTRAYNHADPDKYRLPLNNDLIPYRFDDRLGW
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagcattcaagaaggatcgccagacggtgacaccggaagggaaatccgttctc
ccgctgatccatgatgtgcgtattcgctctgctgtgacacaccccgatgaacgcggaact
atttgcgaaatttataattcggcctgggacttctcggaggcgcctgtggtatacgtgtac
caggtgaccgtacgtccgcaacggatcaagggctgggtcgtccattaccagcaggatgat
cgagtgttcgtcagccagggagttctgaagatcgtcatgtacgaccctcgcaaggaatcg
cccacgcacggcatgctgaatgaactgtgtatcagcgagcacaatcgagggttgttattt
atcccccgcggggtctaccatgcgctacaaaatgttgggaccactgacgcgttgttcatc
aacatgccgacacgcgcatacaaccacgccgacccggataagtatcgcctcccgctgaac
aacgatctgatcccgtatcgttttgacgatcggttaggctggtag

DBGET integrated database retrieval system