KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1018Help
Entry
DAMO_1018         CDS       T02155                                 

Gene name
pncA
Definition
Pyrazinamidase/nicotinamidase (PZAase) (Nicotine deamidase) (NAMase) (EC:3.5.1.19 3.5.1.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    DAMO_1018 (pncA)
Enzymes [BR:mox01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     DAMO_1018 (pncA)
    3.5.1.-  
     DAMO_1018 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861646..862251
Genome map
AA seq 201 aa AA seqDB search
MCPPEPQKLSLNLGDALIVVDVQNDFLPGGSLAVPQGDDVIPVLNRYLADFARRGLPIFI
TRDWHPPDHCSFQPYGGPWPPHCVAGSEGAAFAPALELPASSTRITLKGTQPEKDAYSAF
DGTDLDVRLRAHGVGRLFVGGLATDYCVLCTVEDGLKAGYAVVLLQDAVRAVNVRPGDGE
RAEAEMIRRGAIPIRLEMLAV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccgccggagccgcagaagctcagcctgaacctgggggatgccctgatcgttgtg
gatgtccagaacgattttctgccggggggtagcttggcggtgccgcaaggggatgacgtc
atccctgtcctcaatcgctacctggccgattttgcgcgccgaggcctgccgatcttcatc
acccgagactggcacccccctgatcactgttcgtttcaaccatacgggggaccttggcct
cctcattgtgtggccggttcggaaggcgcggcgtttgcccccgccctcgaacttcccgcc
tccagtacccgcattaccctcaaaggcacgcagccagagaaggacgcctattccgcgttc
gacggaacggatcttgatgtacggctgcgcgcccatggcgtagggcgcctctttgtcggc
ggcctggcgaccgactactgcgtcctgtgtacggtagaggatggtctgaaggccgggtat
gcggtcgttctccttcaggatgcggtccgggccgtcaatgtgcgccccggtgacggagaa
cgggcggaagcggagatgattcgacggggggccataccgatccgactggagatgctggct
gtatga

DBGET integrated database retrieval system