KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1039Help
Entry
DAMO_1039         CDS       T02155                                 

Gene name
thrC
Definition
threonine synthase (TS) (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DAMO_1039 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DAMO_1039 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DAMO_1039 (thrC)
Enzymes [BR:mox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DAMO_1039 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
878197..879450
Genome map
AA seq 417 aa AA seqDB search
MVLVKGLKCRECGRPYPADPLHVCEYCFGPLEVDYDYDAIRGRLTRKAIEAGPPSIWRYK
ALLPIEGEPVVGKHCGMTPLVRANNLARALGMREVYVKNDTVSHPTFSFKDRVVAVAVTK
AVEFDFKVVACASTGNLANSVAAHAAEGGLPSFVFVPADLEQGKVLGTLIYNPKLVAVDG
NYDEVNRLCSEIADKYGWAFVNINIRPYYAEGSKTFGYEIAEQLGWRVPHHIVVPAAGGS
LVTKILKGLKEFDRLGLLDGGCHTRMHVAQAEGCGPIVTAIKENSEIIRPVKPKTIAKSL
AIGNPADGYYAYKAVKGSGGHGEHATDEEIVDAMKLLARTEGIFAETAGGVTVAAAKRLI
EQGRIPRDESLVLCITGNGLKTQEAVAASLKVRFHIKPTLRSFDEAMASHDIDVTSR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggtgaagggactcaagtgcagagagtgcggtagaccatatccggctgatccc
ctgcatgtctgtgaatattgtttcgggcctcttgaggtcgattatgattacgacgcgatt
cgaggcagattgacgagaaaggcgatcgaggccggaccgcccagcatctggcgatacaag
gcgctgctgccgatcgaaggggagcccgtagtcgggaaacactgcgggatgacgcccctc
gtgcgggccaataacctggcgcgtgcgttaggtatgcgggaggtctatgtcaagaacgat
accgtcagccatcctacgttttcatttaaggatcgggtcgtggcggtggcggtgacgaag
gccgtcgagtttgactttaaggtggtggcctgcgcgtccaccggcaatctggcaaattcg
gtggcggcccatgccgccgagggagggcttcccagcttcgtatttgtgccggccgacctg
gaacagggcaaggtgttgggcaccttgatctataacccgaagctggtggctgtagacggt
aactacgatgaggtgaatcgcctgtgcagcgagatcgccgataaatatgggtgggcattt
gtgaatatcaacatccgaccctactacgctgagggttcgaagaccttcgggtacgagatt
gcagagcaacttggctggcgcgtaccccaccatatcgttgtgccggccgcggggggttcg
ctggtcacgaagatcttgaaggggctgaaggagttcgatcggctcggtctcctggatgga
ggctgccacacgcggatgcatgtggctcaagccgaaggatgcggtccgattgtcaccgct
atcaaggagaacagcgagatcatcagaccggtgaagccgaagaccatcgccaagtcgctt
gccatcgggaacccggcggacggctactacgcctacaaggcggtcaaagggagcggtggt
catggggagcacgcgacggatgaggagattgtagacgcgatgaagctgttggcgcgcacc
gaagggatcttcgcggagacggcaggcggggtgacggtagcggcggccaagcgactgatc
gagcagggccgcatccctcgagatgaaagtctggtgctctgcattaccgggaacgggttg
aagactcaggaggcggtcgccgcatcattgaaggttcggttccacatcaagccgaccctt
cgatcgttcgacgaggcgatggcgtctcacgacattgacgtgacgtcaaggtga

DBGET integrated database retrieval system