KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1039Help
Entry
DAMO_1039         CDS       T02155                                 

Gene name
thrC
Definition
threonine synthase (TS) (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DAMO_1039 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DAMO_1039 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DAMO_1039 (thrC)
Enzymes [BR:mox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DAMO_1039 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
878197..879450
Genome map
AA seq 417 aa AA seqDB search
MVLVKGLKCRECGRPYPADPLHVCEYCFGPLEVDYDYDAIRGRLTRKAIEAGPPSIWRYK
ALLPIEGEPVVGKHCGMTPLVRANNLARALGMREVYVKNDTVSHPTFSFKDRVVAVAVTK
AVEFDFKVVACASTGNLANSVAAHAAEGGLPSFVFVPADLEQGKVLGTLIYNPKLVAVDG
NYDEVNRLCSEIADKYGWAFVNINIRPYYAEGSKTFGYEIAEQLGWRVPHHIVVPAAGGS
LVTKILKGLKEFDRLGLLDGGCHTRMHVAQAEGCGPIVTAIKENSEIIRPVKPKTIAKSL
AIGNPADGYYAYKAVKGSGGHGEHATDEEIVDAMKLLARTEGIFAETAGGVTVAAAKRLI
EQGRIPRDESLVLCITGNGLKTQEAVAASLKVRFHIKPTLRSFDEAMASHDIDVTSR
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggtgctggtgaagggactcaagtgcagagagtgcggtagaccatatccggctgatccc
ctgcatgtctgtgaatattgtttcgggcctcttgaggtcgattatgattacgacgcgatt
cgaggcagattgacgagaaaggcgatcgaggccggaccgcccagcatctggcgatacaag
gcgctgctgccgatcgaaggggagcccgtagtcgggaaacactgcgggatgacgcccctc
gtgcgggccaataacctggcgcgtgcgttaggtatgcgggaggtctatgtcaagaacgat
accgtcagccatcctacgttttcatttaaggatcgggtcgtggcggtggcggtgacgaag
gccgtcgagtttgactttaaggtggtggcctgcgcgtccaccggcaatctggcaaattcg
gtggcggcccatgccgccgagggagggcttcccagcttcgtatttgtgccggccgacctg
gaacagggcaaggtgttgggcaccttgatctataacccgaagctggtggctgtagacggt
aactacgatgaggtgaatcgcctgtgcagcgagatcgccgataaatatgggtgggcattt
gtgaatatcaacatccgaccctactacgctgagggttcgaagaccttcgggtacgagatt
gcagagcaacttggctggcgcgtaccccaccatatcgttgtgccggccgcggggggttcg
ctggtcacgaagatcttgaaggggctgaaggagttcgatcggctcggtctcctggatgga
ggctgccacacgcggatgcatgtggctcaagccgaaggatgcggtccgattgtcaccgct
atcaaggagaacagcgagatcatcagaccggtgaagccgaagaccatcgccaagtcgctt
gccatcgggaacccggcggacggctactacgcctacaaggcggtcaaagggagcggtggt
catggggagcacgcgacggatgaggagattgtagacgcgatgaagctgttggcgcgcacc
gaagggatcttcgcggagacggcaggcggggtgacggtagcggcggccaagcgactgatc
gagcagggccgcatccctcgagatgaaagtctggtgctctgcattaccgggaacgggttg
aagactcaggaggcggtcgccgcatcattgaaggttcggttccacatcaagccgaccctt
cgatcgttcgacgaggcgatggcgtctcacgacattgacgtgacgtcaaggtga

DBGET integrated database retrieval system