KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1414Help
Entry
DAMO_1414         CDS       T02155                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
mox00260  Glycine, serine and threonine metabolism
mox00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mox01100  Metabolic pathways
mox01110  Biosynthesis of secondary metabolites
mox01130  Biosynthesis of antibiotics
mox01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DAMO_1414 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DAMO_1414 (trpB)
Enzymes [BR:mox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DAMO_1414 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: CBE68474
UniProt: D5MFE3
Position
complement(1204231..1205466)
Genome map
AA seq 411 aa AA seqDB search
MSKPEKPTRAEASDRGPLPDACGHFGRYGGKFVPETLMAALAELETVYLQAKADPHFEPE
LQGYLRHYVGRPTPLYFAQRLTDYLGGSRIYLKREDLCHTGAHKINNTLGQILLACRMGK
SRVIAETGAGQHGVATATVAARFGLTCEVYMGTEDMRRQALNVVRMRLLGAKVTPVESGS
RTLKDAINEAMRDWVTNVETTHYVLGSVLGAHPYPMMVRDFQSVIGRETRTQILELEGRL
PDYLVACVGGGSNSIGLFHNFLNEPTVRMVGVEAAGLGIDSGRHAARFATGELGVLHGTL
SFILQDSDGQIRPTHSVSAGLDYPSVGPEHSYYRDRGRIDFVSATDAEALEAFQLLSRLE
GLIPALESAHAIAHVKKLAPTLGKDQIVVVNLSGRGDKDVEVVAKLLECAG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaagccagaaaagccgacgcgcgctgaggcgtccgatcggggtccgcttcccgat
gcgtgcggacacttcggcaggtacggagggaagttcgttccggaaaccctgatggcggca
ctcgctgagttggagacggtctatctccaggcgaaggccgacccacattttgaaccggag
cttcagggctatcttcggcattatgtggggcgtcccacacctctctattttgcgcagcga
ctgaccgactatttaggcgggtcgcggatctatctcaaacgtgaggatctgtgccatacc
ggggcgcataagatcaacaatacccttggccagatcttgctcgcctgccgcatggggaag
tcccgggtcatcgccgagaccggtgccggacagcatggggtagccacagccaccgtagcc
gcccgtttcggcctgacttgcgaggtctatatgggtacagaggatatgcgacggcaggcc
ttgaacgtcgtccgaatgcggctgctcggcgccaaggtgactccggttgagtccggcagc
cggacgctgaaggacgccatcaatgaggcgatgcgtgactgggtcaccaacgtcgagacg
acccattatgtgctaggctcagttctcggggcccatccgtatccgatgatggttcgggat
tttcaatcggtcattggccgggagactcgaacccagatcctggagttggagggacgactg
ccggattacctggtagcctgcgtcggaggcggcagcaactcgatcggtctgttccataac
tttcttaatgagcccactgtgcgaatggtcggagtagaggcggccggccttggcatcgac
agcggtcgccatgcagcccgatttgcgacgggcgagctgggcgtcctgcacgggacgctg
agcttcatcctgcaggatagcgatggccagatccgaccgacgcactcggtctcagccggt
ctcgattatccgagcgtcggtccggaacacagttactaccgtgaccgcgggcggatcgat
tttgtctcggcgaccgacgcggaggcgctggaggcgtttcagcttctgagccggctcgag
ggattgattccagcgttggagagcgcacatgctatcgcccacgtcaagaaactggcgccg
acactgggcaaggatcagatcgtggtagtgaatctctcagggcgaggtgacaaagacgtg
gaggttgtcgcgaagctgttggagtgcgcggggtag

DBGET integrated database retrieval system