KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1564Help
Entry
DAMO_1564         CDS       T02155                                 

Gene name
folP
Definition
dihydropteroate synthase (DHPS) (Dihydropteroate pyrophosphorylase) (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mox00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1324462..1325313)
Genome map
AA seq 283 aa AA seqDB search
MTQQTQLRFRCRDHLLDIRQKTWIVGVLNITPDSFSDGGRFLDPRAATDQAMRMVEEGAD
IVELGGESTRPGADVVPVDEELRRILPVLRELRPRLAIPVAVDTYKPEVARVALEEGADI
INDVYGVRGEGRLASVVAEKRAGLVIMHMKGIPQDMQIEPRYNDVVGEVSAFLTDRVAFA
EQRGVDPQSIIVDPGLGFGKRSQDNLALLRHLAALHCLGKPIMVGPSRKSLVGEVLKLPV
EQRQHGTAACIAAAVLHGAAFVRVHEVRPCAQLVRMLDAIRGA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacagacgcaattacgcttccgctgcagggaccatctgctggatatccggcaa
aagacctggatcgtcggggtgttgaacatcaccccggattctttttccgatggcggtcgc
ttcctggatcctagggcagccaccgatcaggccatgcggatggtggaggagggagctgat
atcgtggaactgggtggtgagtcaacccgtccaggcgccgacgtcgtccctgtagacgag
gagctgcgtcggatccttccggtgctgcgcgagctgcgacccaggcttgcgattccggtg
gcagtggatacctacaaaccggaggtggcgagggtagcgctggaggaaggggcggatatc
attaacgacgtctatggcgttcgaggtgagggacgcttagcgtcggtggtcgccgagaag
cgcgccggtctcgtcatcatgcatatgaaagggatccctcaagatatgcaaattgagccg
cgctacaacgacgttgtaggcgaggtgtcagccttcctgacagatcgcgtcgcgtttgcc
gaacagaggggtgtggatccgcagtccatcattgtcgatccggggctgggcttcgggaag
cggtcgcaggacaatcttgcgctgcttcggcatctggcggcgttgcattgtctcggtaag
ccgattatggtcggtccatcgcgcaagtcgctggttggggaggtgctgaaactgccggtt
gagcaacgtcaacatggcacggcggcctgtattgcggcagcggtgctgcacggcgcagcc
tttgtccgggtccacgaggttcggccctgcgcgcagctcgttcgaatgctggacgccatc
aggggggcctga

DBGET integrated database retrieval system