KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1661Help
Entry
DAMO_1661         CDS       T02155                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mox  Candidatus Methylomirabilis oxyfera
Brite
Enzymes [BR:mox01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     DAMO_1661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1414177..1415211
Genome map
AA seq 344 aa AA seqDB search
MQRRTRGVLIIGVLFSTVLGLSVTGSGAEQAYKLKMPLGLQEDAAYIPPDNPLTVDKISL
GQQLYFDTRLSADGTIACATCHAADKGFSDGRPTSTGIKGQVGGRNAPVTINRLFSQEQF
WDGRSPSLEDQALGPVQNPIEMGHTLEGMVATLDKLSGYREQFKKAFGTGVTKDGVAKAI
ASFERTLLCGNSAFDKFEAGDKQALSASAQRGLTLFRAKKANCVACHTGFNFTDEGYHNL
GVGMDKKDPDLGRFKVTKKESDKGAFKTPTLRNIAASAPYLHDGSAKTLEEVIDFYDKGG
IKNPNLSKEIKPLKLTAQEKGDLAAFMKSLSCPNLKVAAPALPK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgccggacacgaggggtacttattattggcgtactattttccactgtactgggt
ctttccgtcacgggaagcggtgcggaacaagcgtacaagctcaagatgccgttgggtcta
caggaggatgcggcgtatattcccccggacaaccctctgacggtcgacaagatcagcctc
ggtcaacagctctattttgatacgcggctctccgccgacgggactattgcctgcgccacc
tgccacgcggcggacaaagggttttccgacggccgccccacctcgacggggatcaaagga
caggtcggtggccgtaatgccccggtaacgattaatcgtctcttcagccaggagcagttc
tgggacggccggtccccttcgctggaagaccaggcgcttggcccggtgcagaaccccatc
gagatgggccacaccctggaggggatggtggcgactctggataagttgagcgggtatcgg
gagcagttcaaaaaggcgttcgggacaggcgtcaccaaagacggggttgccaaggccatc
gcgtccttcgagcgaacccttctttgcggcaactcagcctttgataagtttgaggccgga
gacaaacaggctctcagtgcgagcgcccagcgcgggcttaccctctttcgtgcgaaaaag
gcgaactgtgtcgcatgccacaccggctttaacttcactgatgaggggtatcataacctc
ggcgtaggtatggacaaaaaggacccggacctcggccgcttcaaggtgactaagaaagag
tccgacaaaggcgccttcaagacgccgaccctgcgcaacatcgccgccagtgcgccctat
ctgcacgacggcagcgccaaaacactggaagaagtgatcgacttctacgacaaaggcggc
atcaagaatccgaacctatcgaaggaaatcaagccgctcaagctgacggctcaggaaaag
ggcgatctggcggcgttcatgaagtcgctgagctgccccaatctcaaggttgccgcgcct
gcgcttcctaaatag

DBGET integrated database retrieval system