KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1666Help
Entry
DAMO_1666         CDS       T02155                                 

Definition
di-heme cytochrome c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mox  Candidatus Methylomirabilis oxyfera
Brite
Enzymes [BR:mox01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     DAMO_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1418904..1419929
Genome map
AA seq 341 aa AA seqDB search
MERWVRGMLIAAALLLIGGVVSRSVAQGPYKLTLPLGLQKEAAYVPPDNPLTAEKIELGR
QLFFDGRLSADGTVSCATCHAPDNGFSDGRPTSIGIKGQVGSRNAPTTVNRLFSQEQFWD
GRAASLEEQALGPIKNPIEMGNTLNGMTATLSSIKGYREQFKRVFGTDVNAAGVAKAIAA
FERSLVCGNSAFDRYEDGDDAALSESEQRGLEIFRERGNCARCHTGFAFTDERYHNIGVG
MDTSNPDLGRYAMTRKESDKGAFKTPTLRDIAASAPYFHDGSTKSLDDVVEFYDRGGTKN
PNLSNEIKRLLLSAPEKADLVAFLKSLSCPDLKVAAPTLPK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggagcgatgggtacgaggcatgctgatcgctgctgccctgctgcttatcggcggcgtt
gttagtcgaagtgtggcgcagggaccgtacaaacttacactacccttggggctgcagaaa
gaggctgcctacgtccctccggataatccgctcacagcagaaaagatcgaactcgggcga
caactgttctttgacggtcgactctctgcggatggaaccgtgtcctgcgccacctgccac
gcgccggataacgggttttcagacggacggccgacctctatagggattaagggacaggta
ggcagccgcaacgcacccaccacggtcaatcgtctcttcagccaggagcagttctgggat
ggtcgggccgcttcactggaagagcaggcgctgggtccgatcaagaatcctatcgagatg
ggcaatacgctaaacgggatgacggccacgctttcttcgattaaaggataccgcgagcag
ttcaaacgggtatttgggacagacgtcaacgcagcgggtgtggcgaaggctatcgcggca
ttcgagcggagcctggtgtgcggcaattcggcattcgacagatatgaagacggcgacgac
gcggcgctctcagagagtgagcagcgaggacttgagatctttcgggagagaggcaattgc
gcacgatgccacaccggctttgcatttaccgatgagcggtaccacaacatcggcgtaggt
atggacacgtcgaacccggatctcggacggtatgcaatgaccaggaaagaatcggacaag
ggagcgtttaagacgccgaccctgcgcgatatcgccgccagcgccccctatttccacgac
ggaagcaccaagagcctggacgatgtcgtcgagttctacgatcggggcggcacgaagaac
ccgaacctgtcgaacgagatcaaacgacttctcttgtcggccccggaaaaagccgacctt
gtggcgtttctgaaatcactgagctgcccggatctcaaggtagccgcgcccactctaccg
aagtag

DBGET integrated database retrieval system