KEGG   Candidatus Methylomirabilis oxyfera: DAMO_1821Help
Entry
DAMO_1821         CDS       T02155                                 

Gene name
cheB
Definition
chemotaxis Response Regulator protein CheB-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mox00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DAMO_1821 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    DAMO_1821 (cheB)
Enzymes [BR:mox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     DAMO_1821 (cheB)
Two-component system [BR:mox02022]
 CheA family
  CheA-CheYBV
   DAMO_1821 (cheB)
Bacterial motility proteins [BR:mox02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    DAMO_1821 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565968..1567029)
Genome map
AA seq 353 aa AA seqDB search
MNNKIRVLIVDDSALMRKMLTVLLGRDPQIEVIGAAADPFFARDKIKALNPDVLTLDVEM
PRMDGLTFLEKLMRGHPMPVVMVSSLTEAGCETTLRALELGAVDFITKPQVDLREHMDEI
AEEIIGKVRAASLARVVRRERREPVLVGAGAATRSPAHGAMIRTTDRVIAVGASTGGTEA
LKDFLTMLPANAPGIVIVQHMPEKFTKSFAERCDQLCTVRVKEAADGDRVLPGHALIAPG
NYHMALRRNGAQYFVNVYSGPPVNRHRPSVDVLFESAAECAGRNAVGVIMTGMGADGAKG
LLRMKQAGARTIAQDEASCVVFGMPKEAIALGAADHILPLPMIPYKTLELAAE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaagattcgcgtcctgattgtggatgattcggcgttgatgcgtaagatgctg
accgtcctgttgggccgcgatccgcagatcgaagtaatcggcgcggcagccgatccgttt
tttgccagagacaagattaaggctctgaacccggacgtcctgaccttggacgttgagatg
ccgcggatggacggcctcacctttttggagaaactgatgcggggccatccgatgccggtg
gtgatggtctcgtccctgaccgaggcggggtgcgagacgacgctgcgcgccctcgagcta
ggggctgtcgattttattaccaagccacaggtggatctcagggagcatatggacgaaatt
gccgaggagatcatcgggaaggtccgggcggcctcattggctcgagtcgttcgccgcgag
aggcgggagccggttctggtcggtgccggggcagcaacccgatcaccggcgcatggggcg
atgatccggacgacggatcgagttatcgccgtgggggcgtctacgggggggaccgaggcg
ctgaaggatttcctcacgatgttgcctgccaacgccccgggtattgtaatcgtccagcat
atgccggagaagtttaccaagtccttcgcggaacggtgtgatcaactgtgcacggttcgg
gtgaaggaggcggccgatggcgaccgcgtcctgccggggcacgcgttgatcgccccgggc
aactatcatatggcattacggcgcaacggcgcccaatatttcgtgaatgtctactctggt
ccgccggtgaatcgacatcgtccgtcggttgatgtcctgttcgaatcggccgccgaatgc
gcaggacggaacgccgtaggtgtgatcatgaccgggatgggggccgacggcgctaaaggt
ctgctccggatgaagcaggccggggcgcgcaccatcgcccaggacgaggcgagttgtgtg
gtgttcggcatgccgaaggaggcaatcgccttgggtgccgcagatcacatcctgccgctt
cccatgattccgtacaagacgctggagttggcggcggagtaa

DBGET integrated database retrieval system