KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2062Help
Entry
DAMO_2062         CDS       T02155                                 

Definition
(RefSeq) threonine synthase (TS) (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DAMO_2062
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DAMO_2062
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DAMO_2062
Enzymes [BR:mox01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DAMO_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1782889..1784745)
Genome map
AA seq 618 aa AA seqDB search
MAARGRRREARFYELYCIVCGTTCTEQESSSRCVSCGKPLGVRYDYSYIRARLNRYSLKT
SPIKALKYLDFYPILNLDLVVSLDEGGTPLYRCHRLAEELGIKQLYIKNEGMNPTGVFKD
RGTLVEITKAKEQGAKAICVASTGNMAGSVAAYASIANLPCYVAVPEGTPIGKMAQSLSY
GARVLQIRGTYNDAASIAEQMSRRYGYYLAGDYAFRVEGQKSQAFEIVEQLDWQAPAVVI
VPMGCGTNIAALWKGFKEFYELGLISSLPRMIGVQPIGCPPIVAAFNQGTDEIIPVKKPE
SVASALMAGDPLDGLKALAALRESGGCALSLSDTEILQAQQRIARQESIFVEPSGAIPVG
ALALLLTSGRVRADETVVCLATGNGLKDPRAALRVLPSPATIDPSMQEVEKFLKLRLYEI
RAAGAKNGDKNLFEAVPSVTDVTARVRQEFGVKLTAEYGGKVRSLIEEFVKKGKPIMKAD
LQYIVENVLKGLSVHEPILTVEDFKVLTSLHGQAEAAVWVLFDGEKVEATAAGVGPVDAV
INALKQAALTRGKLFFELIDYNVEISSPGTNASVETTMVMKDAEGNRIVAIGTSPDIIVA
SVNAFVEGYNLLWARQKG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaggggacggcgtagggaagccaggttttatgagctctactgcattgtgtgc
ggcacgacctgcaccgagcaggagagcagttcgcgttgcgtcagttgcggcaagccgctt
ggcgttcgttatgactatagctatatccgggctcgcctcaatcgatactcactgaagacc
tctccgatcaaagcgctcaaatatctcgatttctaccctatcctcaatctcgatcttgtg
gtctcgcttgatgagggcggaacaccgctgtaccggtgccatcggttagcggaggagttg
gggatcaagcagctctatatcaaaaatgaggggatgaatccgaccggcgtgttcaaggat
cgagggacgctggtcgaaatcaccaaggctaaagaacaaggcgccaaggcgatctgcgtg
gcctctaccggcaatatggccggttccgtcgccgcctatgcctcgatcgcgaatttgcca
tgctatgtggcggttccggagggaaccccaatcggaaaaatggcccagtctctttcctat
ggcgccagggtcctgcagatccgagggacgtataacgatgcggcctccattgccgagcag
atgagccgacgatatgggtattatctggccggcgattacgcctttcgcgtcgaaggccag
aagtcacaggcgttcgagattgtggagcagttagactggcaggccccggccgtcgttatt
gttcccatgggctgcgggaccaacatcgccgctctctggaaggggttcaaagagttttat
gagctggggttgatctcgtctttgccgcggatgatcggtgtccagccgatcggttgtccg
ccgatcgtggctgcgtttaaccagggcaccgacgagattattcctgtaaagaaaccggaa
tcggtcgcctcagcactgatggcaggcgatccgttggatgggctgaaggcactggcggcg
ttgcgagaatctggcggatgcgcgctatcgctcagtgataccgagatcttgcaggcgcag
cagcggatcgcgcgccaggagtcgatcttcgtggagccgtccggggcgattcccgtcggg
gcgctcgcgctgctgctgaccagcgggcgtgtgagggcggatgagacggtggtctgcctc
gccacagggaacgggctcaaggatcccagggcggcgctacgagtcctcccgtcgcccgct
accatcgatccgtcaatgcaggaggtcgagaagttcctgaagctgcgcctgtatgagatc
agggccgcaggcgccaagaacggcgataagaacctgtttgaggcagtcccctcagtgacc
gacgtgaccgcgcgggtacgacaggagttcggcgtcaagctgaccgccgaatacggcggt
aaggtacgatcattgatcgaggagtttgtgaagaaggggaagccgatcatgaaggccgac
cttcagtatattgttgagaatgtcctcaagggtctatcggttcacgaaccgatcctcacc
gtagaggactttaaggtattgacgtcgctccatggtcaggcggaagcggccgtctgggtc
ctgttcgacggggagaaagtggaagcgaccgctgcaggtgtcgggccggtggatgcggtc
atcaacgccctgaaacaggccgccttgacccgcgggaagctcttcttcgagctgattgac
tacaatgtagaaatcagctcacccgggaccaatgcctcggtcgagaccaccatggtcatg
aaggacgctgaaggcaaccgaatcgtcgccatcgggacttcccccgacatcatcgtcgcc
tcagtcaacgccttcgtggaggggtataacctactctgggcgcggcagaaggggtga

DBGET integrated database retrieval system