KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2065Help
Entry
DAMO_2065         CDS       T02155                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (Protein-beta-aspartate methyltransferase) (PIMT) (Protein L-isoaspartyl methyltransferase) (L-isoaspartyl protein carboxyl methyltransferase) (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mox  Candidatus Methylomirabilis oxyfera
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1785974..1786636)
Genome map
AA seq 220 aa AA seqDB search
MADRYEAGAEAARWRMVEQQLRTRDIVDERVIAAMGKVARHLFVEPALEQCAYEDRPLSI
GAGQTISQPYIVALMVQLLRVQPRHLVLEVGTGSGYQAAILAELAAEVYTVEIIPSLAER
AGARLEALGYRNVYVRQGDGYEGWPEVAPFDGIVVAAGAPEIPLPLIEQLREGGRIAIPV
GVARGTQDLILGEKRGGKLQVRSIAPVLFVPLTGKGGAEQ
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
gtggcggaccggtatgaagcgggcgcagaagcggcgcgatggcggatggtggagcagcag
ctcaggactcgcgacatcgtcgatgaacgggtcattgcggcgatggggaaggttgcccgc
cacctgttcgtagagccggccctggagcagtgtgcctacgaagaccgccctctctctatt
ggggcaggacagaccatttcgcagccgtacattgttgcgctcatggtccagctcctccgg
gtgcaaccgaggcatctggttcttgaggttggaaccggttcaggctatcaagctgcgatc
ctggccgagttggcggccgaggtctataccgtcgaaattatcccgtcgcttgcagagcgt
gccggcgcccgtctggaggctctcggataccggaatgtgtatgtccgacagggagatgga
tacgagggatggccggaggttgccccctttgacgggatcgtggttgcggccggcgctccg
gagattcccctcccgttgatcgagcagttgcgcgagggagggcgaatagcgattccggtg
ggggttgcgaggggaacgcaggacctgatcctcggggagaagcgcggtgggaaattgcag
gtccgttcgattgcgcctgtgctgttcgtgccgttgacgggaaagggaggcgctgagcaa
tag

DBGET integrated database retrieval system