KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2247Help
Entry
DAMO_2247         CDS       T02155                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Enoylpyruvate transferase 1) (UDP-N-acetylglucosamine enolpyruvyl transferase 1) (EPT 1) (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mox00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mox00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1927719..1928999)
Genome map
AA seq 426 aa AA seqDB search
MRQGARGRMDRLIIRGGVPLRGQVEAGGAKNAALPEMVASLLTGESIQLHRVPQLGDVKT
TIGLLSHLGVSVERRDRETLSLRADGIGQCEAPYQLVKTMRASVLVLGPLVARFGRARVS
LPGGCAIGSRPINLHLAALEKMGATVSLDAGYVEAKASRLKGARITFDGQTVTGTENVMM
AATLADGVTVLENAACEPEVVDLAALLNGMGASIEGAGTPTITIEGVSHLHGAAHEVIPD
RIETGTFMVAAAITGGDVTVTHCLPGHLEAITEKLRETGVLIEETDRSIRVLGDGQLRGV
NVRTHPYPGFATDMQAQFMALMSIAQGSSVITETVFENRFMHVNELLRMGADIKVIGTTA
FVHGIPMLSGAPVMATDLRASASLVLAGLAAQGTTTVSRVYHLDRGYESIETKLQGLGAD
IERVAE
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccaaggcgcgagagggcgcatggataggctgattatcagaggcggggtccccctc
agaggacaggtggaggctggtggcgcaaagaacgcggccctgccagagatggtggcctcg
ttgcttacaggagagtcgatccagcttcatcgtgttccgcaattgggcgacgtgaagacg
actatcggtctgctcagccatttaggtgtgagcgtcgaacgacgcgatcgagagactcta
tcccttcgtgccgatggcatcggtcagtgtgaggcgccctatcaactggtcaagacgatg
cgggcatcggtactggttctcggccccctggtggcccgattcggacgagcacgggtctct
ttgccgggagggtgcgccatcgggtcacggccgatcaatctgcatctggcggcgcttgag
aagatgggtgcaacggtcagccttgacgcaggatacgttgaagcgaaggcgtcgcgtttg
aagggcgccaggattacattcgatggccagaccgtcaccggcactgagaatgtaatgatg
gccgccacgctggccgatggggtgacggtgctggagaacgctgcgtgcgagcccgaggtc
gtcgacctggccgctctgctgaatggtatgggcgcgagcatcgagggcgcgggaacgccg
acgatcactatcgagggcgtctcgcatctgcacggagcagcgcacgaggtgattccggac
aggatcgagacggggacctttatggttgcggccgcgatcaccggcggagacgtcaccgtc
actcattgcctgccgggccacctggaggcgattacagagaaactgcgggagaccggcgta
ctgatagaggagacggaccgcagtattcgggtcttgggagacggacaattgcgaggggtc
aatgtcagaacccatccctatccaggatttgccaccgatatgcaggcgcagttcatggcg
ctgatgtctattgcccaggggagcagcgtcatcaccgagaccgtatttgagaaccgattc
atgcacgtgaatgagctgctgaggatgggtgcggatatcaaggtgatcggcactacggcg
tttgtccatggcattcccatgctatcgggcgcaccggtgatggcgaccgatctgcgggcg
agcgcatcgctggttctcgcaggactggccgctcaggggaccaccaccgtctcgcgagtc
tatcatctcgaccggggatatgagtcgattgaaacaaagcttcagggccttggcgccgac
atcgagcgagtcgcagaataa

DBGET integrated database retrieval system