KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2403Help
Entry
DAMO_2403         CDS       T02155                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mox03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2061747..2062373
Genome map
AA seq 208 aa AA seqDB search
MIAQLRGLLASKDPGQIVIDVNGVGYQVFVPLSTFYQLPEIQQEVHLRIYTHVREDAIQL
YGFHAIEERITFELLTGVSGIGPRLAANILSGIAVEEFIPAVLEGDTARLKAIPGVGRKT
AERIILELKDKVTEVPCRGRVVVDRQPSPERDRTIEDVVSALLNLGCSRKEASAAAEAAH
HTVGDGTDFETLVKQALKHLSERTGKRL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctcaacttcgcggtctattggcgtccaaggatcccgggcagattgtgatcgac
gtcaacggggtcggctaccaagtctttgttccgctttcgacattctatcagctcccggag
attcaacaggaggtgcaccttcgcatctacacgcatgtccgcgaggatgccatccagctt
tacgggtttcatgcgatcgaggagcggataacgttcgaactgctgacaggggtctccgga
atcggacctcgcctcgcggctaacatcctgtccggaatcgcagtggaggagttcatcccg
gctgtcctggagggcgataccgcaagactcaaggcgattccgggggtggggcggaaaaca
gccgagcggatcatcctggagttaaaggacaaggtcacagaggtcccctgtagaggtcgg
gtcgtggtcgaccgccagccgagcccggaacgagatcggaccatcgaggatgtcgtctcc
gcactgctgaacctgggctgcagtcgcaaagaggcctcggcggcggctgaggcggcgcat
cataccgtcggcgatgggacagactttgaaacgttggtcaagcaggccctgaagcatctc
tccgagaggacggggaagcggctatga

DBGET integrated database retrieval system