KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2403Help
Entry
DAMO_2403         CDS       T02155                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mox00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    DAMO_2403 (ruvA)
Enzymes [BR:mox01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     DAMO_2403 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2061747..2062373
Genome map
AA seq 208 aa AA seqDB search
MIAQLRGLLASKDPGQIVIDVNGVGYQVFVPLSTFYQLPEIQQEVHLRIYTHVREDAIQL
YGFHAIEERITFELLTGVSGIGPRLAANILSGIAVEEFIPAVLEGDTARLKAIPGVGRKT
AERIILELKDKVTEVPCRGRVVVDRQPSPERDRTIEDVVSALLNLGCSRKEASAAAEAAH
HTVGDGTDFETLVKQALKHLSERTGKRL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgctcaacttcgcggtctattggcgtccaaggatcccgggcagattgtgatcgac
gtcaacggggtcggctaccaagtctttgttccgctttcgacattctatcagctcccggag
attcaacaggaggtgcaccttcgcatctacacgcatgtccgcgaggatgccatccagctt
tacgggtttcatgcgatcgaggagcggataacgttcgaactgctgacaggggtctccgga
atcggacctcgcctcgcggctaacatcctgtccggaatcgcagtggaggagttcatcccg
gctgtcctggagggcgataccgcaagactcaaggcgattccgggggtggggcggaaaaca
gccgagcggatcatcctggagttaaaggacaaggtcacagaggtcccctgtagaggtcgg
gtcgtggtcgaccgccagccgagcccggaacgagatcggaccatcgaggatgtcgtctcc
gcactgctgaacctgggctgcagtcgcaaagaggcctcggcggcggctgaggcggcgcat
cataccgtcggcgatgggacagactttgaaacgttggtcaagcaggccctgaagcatctc
tccgagaggacggggaagcggctatga

DBGET integrated database retrieval system