KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2927Help
Entry
DAMO_2927         CDS       T02155                                 

Gene name
mtnD
Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (5-methylthio-3-oxo-1-penten-1,2-diol dioxygenase) (DHK-MTPene dioxygenase) (EC:1.13.-.-)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    DAMO_2927 (mtnD)
Enzymes [BR:mox01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     DAMO_2927 (mtnD)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     DAMO_2927 (mtnD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2522243..2522776)
Genome map
AA seq 177 aa AA seqDB search
MATIKLHPDNRRIEVPAEMAGFLEKEGLVYRNWDVSKLREELRGNYALTEAEKAEILATF
EGDLQKLKAEGGYVSADIVVLWDKTPDLETLLDKFNREHHHSEDEVRFVVDGHGIFTIRG
RSGQYFDMMVGPGDLITVPAGTRHWFTLAEDRRIKCIRLFQDPAGWAAIYDASAGRS
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaatcaagttgcaccctgataaccggcgcatcgaggtaccggcagagatggcg
gggtttctcgagaaggagggcctcgtctaccgcaactgggatgtgtcgaagttgcgagaa
gagttacggggcaactatgccctgaccgaggctgaaaaggcagagattctggcgacgttt
gaaggcgacctgcagaagctcaaggctgagggggggtatgtgtcagccgacatcgtcgtt
ctctgggacaagacccccgacctggagacgttgctcgacaagttcaaccgggaacaccat
catagcgaggacgaggtacgattcgtggttgacggccacggtatcttcacgatccgcgga
cggagcggccagtactttgatatgatggtaggtccaggcgatctgattacagtgcctgcg
ggtacccgtcactggttcaccctggccgaggataggcggatcaagtgcattcgcctcttc
caggaccctgctggttgggccgccatctacgacgcctccgctggtcgttcgtaa

DBGET integrated database retrieval system