KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2995Help
Entry
DAMO_2995         CDS       T02155                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    DAMO_2995
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAMO_2995
  Lipid metabolism
   00071 Fatty acid degradation
    DAMO_2995
  Amino acid metabolism
   00350 Tyrosine metabolism
    DAMO_2995
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DAMO_2995
   00626 Naphthalene degradation
    DAMO_2995
Enzymes [BR:mox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     DAMO_2995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2586649..2587677
Genome map
AA seq 342 aa AA seqDB search
MNRVLTEAAFMRALCLNSVRPIEDHPLTMVELPAPIPGPGGLRLRVQACGLCRTDLHIIE
GDLPLPMLPIVPGHQIVGVIDEVGQGVTRFHVGDRVGVPWLYSTCSQCTFCRRNQENLCD
AARFTGYHVNGGYAECVVVQEAFAYPLPSGISTTNAAPLLCAGVIGFRALRLSGIKPGER
LGLYGFGGSAHIAIQVAVYWGCEVAVFTRSEAHRALALQLGARWAGPVEDDPPGRLDSAV
IFAPVGSLVLEALRVLRKGGTVAIAGITMSPIPELDYSLLYQERTVRSVANSTRQDVHDL
LRLAVDIPIRTTIRTFPLEEANHALQLLKHSRFSGAGVLTIS
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ttgaatagggtgttgacggaggctgcgttcatgcgggcgctctgtctgaatagtgtacgt
ccgatcgaggaccatccgcttacgatggtcgagctgccagccccgattccgggtcctggc
ggacttcgcctacgggtgcaggcttgcggtctgtgccgaaccgacctgcatatcatcgaa
ggcgaccttccgcttcctatgcttccgatagtgcccggccaccagattgtcggtgttatc
gatgaggtcggacaaggcgtcacccgctttcacgtaggcgatagagtgggcgttccctgg
ctgtactccacgtgcagccaatgcaccttctgccgacgtaatcaggaaaatctctgcgac
gcagcccgctttaccggctaccacgtgaacggtgggtatgcggagtgtgtggttgtccaa
gaggcatttgcatatccgttgccgtcaggcatctcgaccaccaatgcggccccattgctg
tgcgcaggggtcatcggcttccgcgcccttcgactgagcggaatcaagcctggtgagcgt
ctggggttatatgggttcggcggctcggcgcatatcgccatccaggtcgcggtctactgg
ggttgcgaggttgctgtctttacccggagcgaggcgcatcgcgccttggccttgcaactc
ggcgcccgctgggcaggcccggtcgaagacgatccgccggggcgactcgacagtgcggtc
atcttcgcgcccgtcggatcgctggtgctcgaggcgcttcgagttctcagaaagggcggc
acggtggccatcgccggcattaccatgagtccgatcccggagcttgactactccttactc
taccaggagcggaccgttcggagcgtagccaacagcacgcggcaggatgtgcatgatctc
ttgcgcctcgcagtagacattccgattcggaccacgatccgcacctttcccctcgaagag
gccaatcacgccctccaacttctcaagcacagccggttcagcggcgccggcgttctgact
atctcctag

DBGET integrated database retrieval system