KEGG   Candidatus Methylomirabilis oxyfera: DAMO_3035Help
Entry
DAMO_3035         CDS       T02155                                 

Definition
protoporphyrinogen IX and coproporphyrinogen III oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DAMO_3035
Enzymes [BR:mox01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     DAMO_3035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2631530..2633017
Genome map
AA seq 495 aa AA seqDB search
MATEQHSGSRRIVVVGSGIAGLAAAYRLQERCEQDGPPCEVRVLEAAARPGGAISTTHRD
GFVLESGPDTIFTDKPWGLDLIRRLGLSEQVIGTNEAHRRTFVVRDGALHPLPEGFALMG
PTKPWPFLQSGLLSWRGKARAALDLVLPRGGPSDDESLASFVRRRFGQEFLDRLAQPMIG
GIYGADPERLSLRATFPQFLQMEATHRSVILGLRRMRPAGRGVGHTSSGPRYGLFVTLDH
GLQALVDAMVKRLPAGTLRLRAPVDRIAHTEQGWTVRLGDGASLQADGLILAVPAFEIAR
LTHDLDQDLARQLEAMPYASSVTINLAYRREAIHHPLDGFGFVVPACEGRTIIACSFSSV
KFAHRAPAGHVLLRAFAGGALQPEPFTWDDETLLSAVRRDLEELLAIHAPPLWSQLVRHP
RVMPQYQVGHLGRLAALEETLRRWPTLKLTGNAYRGVGVPDVVHSGETAADSLLAELAPS
PTEPTPACTEGDSRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaacagcacagcggcagcaggcgtatcgtggtggtggggagcggcatcgcg
ggtctggctgccgcctatcggctgcaggagcggtgcgagcaggacggcccgccttgcgag
gtgcgcgtattggaggccgctgcacggcccggcggtgcgatcagtaccacgcaccgggat
ggttttgttcttgaatctgggcccgataccattttcaccgataagccgtggggattggat
ctgatcagacgcctcggtctgagcgagcaggtcatcgggaccaatgaggcgcaccgccgg
acctttgttgtgcgggacggcgcactgcacccgctgcccgaagggttcgccttgatgggg
ccgaccaagccttggccgtttctgcaatcagggctgctgtcatggcgcggcaaggcaagg
gcggctctggacctggtactgccgcgagggggaccatccgacgacgagagcctggcgtcg
ttcgttcggcgtcgtttcggacaggagtttctcgatcggctggcccaaccgatgatcggt
ggaatctatggcgccgacccggagcggttgagtctgcgcgctaccttcccgcagtttctg
cagatggaagcgacgcatcgcagcgtgatcctcggcctgcgacgaatgcgccccgccggc
cgcggcgtaggtcataccagcagcggcccgcgctatggcctgtttgtcacgctggatcac
gggctgcaggccctcgtcgatgccatggtaaaaaggctgccggctgggacgctgcgtctc
cgcgcgccggttgatagaatcgcgcacacagagcaaggctggaccgttcgacttggagac
ggcgcgagcctgcaggccgatggccttattctcgccgtccccgcatttgagattgccagg
cttacccacgacctggaccaagacctggctcgtcagctcgaggccatgccctacgcctct
tcggtcacgatcaatctggcctatcgtagagaggcgatccaccatccgctcgacgggttt
ggatttgtggtgccggcctgcgaggggcgcaccatcattgcctgttcgttcagcagcgtg
aagttcgctcatcgggcgccggccggtcacgtcctgctgcgtgccttcgcgggcggcgcg
ctgcagccggagccgttcacctgggatgacgagacgctgctgagcgcagtgcgccgcgat
ctggaggagctgctggcgattcacgcgccgcctttgtggagccagttggtccgacatcct
cgtgtgatgccccagtaccaggtcggccacctgggccggttggcggcgctcgaagagacg
cttcggcggtggccgaccctcaagctgaccggtaacgcctacagaggtgtcggtgtgccg
gatgtggttcacagcggggagacggccgccgattcattattggcagagctggccccgtca
ccgaccgagccgacccccgcttgtaccgaaggcgattctcgcctataa

DBGET integrated database retrieval system