KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0280Help
Entry
MAP0280           CDS       T00156                                 

Gene name
celA
Definition
hypothetical protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAP0280 (celA)
Enzymes [BR:mpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MAP0280 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
297219..298208
Genome map
AA seq 329 aa AA seqDB search
MTFSAAGAVARWIVPLFTVAALVGIGPVAEPAPAVRLAADGNPLAGAPFYVNPNSAAMRA
AQSADPPSPELTTIANTPQAYWIVPGGSAATVGKYVGDANAAGAIPVLAIYGIPHRDCGS
FAAGGMATADDYRGWIDGIAAGVGTSRVAIVVEPDALAMADCLSGDQRQERYELVRYAVD
TLTRNPNAAVYVDAGHLRWHSPEDMAARLNQAGVAHARGFSVNTANFYTTEDEIGYGEAI
SGLTNGAHYVIDTSRNGAGPAPDSELNWCNPSGRALGTPPTAATAGAHADAYLWIKRPGE
SDGSCGKGDPPAGNFVNQYAIDLVHNVGH
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacattctcagctgccggcgcggtcgcgcggtggatcgtccctctgttcacggttgcg
gccctggtcggcataggcccggtagccgaaccggcgccggcagtgcggttggccgccgac
ggcaatccgttggccggggcgccgttctacgtcaacccgaactcggcggccatgcgcgcc
gcgcagagcgccgatccgccgagtcccgagttgaccaccatcgccaacacgccgcaggcg
tactggatcgtgccgggcggctcggcggcgacggtcgggaagtacgtcggcgacgcgaac
gctgccggcgccatcccggttttggcgatttatggaatcccgcaccgcgattgcggcagc
ttcgccgcgggcggcatggcgacggccgacgactatcgcggctggatcgacggcatcgcg
gccggtgtgggtacctcgagggtggcgatcgtcgtcgaacccgatgcgctcgcgatggcc
gactgcctgtcgggcgatcagcgccaggaacgctacgagctggtccgctacgccgtcgac
acactgacccgcaaccccaacgcggccgtctacgtcgacgccgggcacctgcgttggcac
agtcccgaggacatggccgcccggctcaaccaggccggcgtcgcacacgcgcgaggattc
agcgtcaacaccgcgaacttttacaccaccgaggacgaaatcggttacggcgaagccatt
tccgggctcaccaatggtgcgcactacgtgatcgacacgtcgcgcaacggagccgggccg
gcgcccgactccgagctcaactggtgcaaccccagcggccgcgcgctgggcaccccgccc
accgcggccaccgcaggcgcccacgccgacgcctacctgtggatcaagcgtcccggcgaa
tccgacggatcctgcggcaagggtgatccgcccgccggcaacttcgtcaaccaatacgcc
atcgatctggtccacaacgtcggccactag

  All links  
No link information was found.   
DBGET integrated database retrieval system