KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0299cHelp
Entry
MAP0299c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MAP0299c
Enzymes [BR:mpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MAP0299c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(319294..320178)
Genome map
AA seq 294 aa AA seqDB search
MGVVVIGQIGRDLVLRTDRPPTAGESATVLRREELLGGKGANQAVGLAQLGVPVALIGVV
GDDQAGTSILQQAQRDGIDVSKVARRGTTALLVDVVAAPPERMLLEDVPDSSLVRVADLD
RSSSLFDTADTVSIQLQQPAATALEAAQRARQRGLRVVADGVPAPQVRADLLATLDVLRA
DATEASIIAGTEITTVEQAFELADHLLSGGPELVALAVPDVGDLLTWRGGSELFEFADVE
VVDPTGAGDAFVAGLVAALRDGAAPREAGRRAAAAAGATVQRLGGRPDLTGLRA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtggtggtgatcggtcagatcgggcgcgacctggtgctgcgcaccgaccggccg
ccgacggccggcgagtccgccaccgtgctgcggcgcgaggagctgctcggcggcaagggc
gccaaccaggccgtcgggctggcgcaactgggtgtgccggtggcgctgatcggggtggtg
ggcgacgaccaggccggcacgtcgatcctgcagcaggcgcagcgcgacggcatcgacgtc
agcaaagtggcgcggcgcggcaccaccgcgctgctggtcgacgtggtcgccgcgccgccg
gaacgcatgctgctcgaggacgtgccggacagttcgctggttcgggtcgccgacctggac
cggtcgagctcgctgttcgacaccgccgacaccgtctccattcagctgcagcagccggcc
gccaccgctttggaagccgcccaacgcgcgcggcagcggggactgcgggtggtggccgac
ggcgtgcccgccccgcaggttcgggccgatctgctggcgacgctggacgtgctgcgggcc
gatgccaccgaagcgtcgatcatcgcgggcaccgaaatcaccacggtggaacaggccttc
gagctggccgaccatctgctgagcggcggcccggagctggtcgcgctggcggttcccgac
gtgggcgacctgctgacgtggcgtggtggcagcgagcttttcgagttcgccgacgtggaa
gtggtggatcccaccggcgccggtgacgcgttcgtcgccgggctggtcgccgccctgcgg
gacggcgccgcaccgcgggaggcgggtcggcgggcggccgcggccgccggggccacggtt
cagcgcctgggcgggcggcccgacctgaccgggctcagggcgtga

DBGET integrated database retrieval system