KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0316cHelp
Entry
MAP0316c          CDS       T00156                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAP0316c (recR)
DNA repair and recombination proteins [BR:mpa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MAP0316c (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(338838..339449)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLARVRDGVRFCAVCG
NVSDDERCRICSDPRRDASVVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGVGPDQ
LRIRELLSRIGERVDDVDITEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggacccgtccaggacctgatcgacgagctgggcaagctgccgggcatcggg
cccaaaagcgcccagcgcatcgcctttcatctgctatcggtcgaaccgcccgacatcgac
cggctgaccgcggtgctggccagggtccgcgacggggtgcggttctgcgcggtgtgcggc
aacgtctccgacgacgagcgctgccggatttgctccgacccccgccgcgacgcgtcggtg
gtgtgcgtggtcgaggagcccaaggacgtgcaggccgtcgagcgcacccgcgaattccgc
ggccgctatcacgttttgggcggtgcgctcgatccgttgtccggggtgggccccgatcag
ctgcggatccgcgagctgctcagccggatcggggagcgggtcgacgacgtcgacatcacc
gaggtgatcatcgccaccgacccgaacaccgagggcgaggcgacggccacctacctggtg
cggatgctgcgcgacattcccggcctgaccgtgacccgcatcgcctccgggctgccgatg
ggcggcgatctggagttcgccgacgagttgacgctgggccgcgcgctggccggccgccgc
gccatggtctga

DBGET integrated database retrieval system