KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0452Help
Entry
MAP0452           CDS       T00156                                 

Gene name
folK
Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
480233..480781
Genome map
AA seq 182 aa AA seqDB search
MTRVVLSIGSNLGDRLARLQSVVDGLGGAVRAISPVYETQPWGRVDQAPFLNAVLIADDP
ACDGQGWLRRAQEFERAAGRVRGERWGPRTLDVDLIACYGDGEVISRENNLTLPHPLAHL
RAFVLIPWLAVDPDAQLTVADGPQPVARLLAQLDQADRDGVRPTGLTLTPPAGSPADSGA
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgttgtcttatccatcggctccaatctgggggaccggctggcgcggctgcag
tccgtcgtcgacgggctcggcggcgcggtgcgcgccatctcgccggtgtacgaaacccaa
ccctggggccgggtggatcaggcgccgtttctcaacgcggtgctgatcgccgacgacccg
gcctgcgacggccagggctggctgcgccgggcgcaggaattcgagcgggcggcgggccgg
gtgcgcggcgaacgctggggcccgcgcaccctcgacgtcgacctgatcgcctgctacggc
gacggcgaggtgatctcccgggagaacaacctgaccctgcctcatccgctggcgcatctg
cgggccttcgtcctgatcccgtggctggccgtcgacccggacgcgcagctgacggtggcc
gacgggccgcaaccggtcgcccgcctgctggcccagctggaccaggccgaccgggacggt
gtccggccgaccggcctgacgctgacaccgcccgcgggctcgccggccgattcgggggcg
ggcagctga

DBGET integrated database retrieval system