KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0532Help
Entry
MAP0532           CDS       T00156                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAP0532
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP0532
   00650 Butanoate metabolism
    MAP0532
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MAP0532
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP0532
   00622 Xylene degradation
    MAP0532
   00621 Dioxin degradation
    MAP0532
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MAP0532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558459..559376
Genome map
AA seq 305 aa AA seqDB search
MPTKAKVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLLAQPEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPPANLRQHLDAP
NVNMITCGGQATIPIVFAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSRGVET
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAQSIHDVVKEVQTYVPGYRLL
NEPQFDEPSLNSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLATT
AGGAQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgactaaagcaaaagtggcgattgtcgggtcggggaacatcagcacggacctgctc
tacaagctgctgcgatccgactggctggaaccacgctggatggtcggcatcgacccgcag
agcgagggcctggcccgggcccgcaagctgggcttggagaccacccacgagggggtcgac
tggctgctggcgcagccggagaaacccgacctggtcttcgaggcgaccagcgcttacgtg
caccgcgacgccgcccccaagtacgaggccgccggcatccgggccatcgacctgacgccc
gccgcggtgggcccggccgtcatcccgccggcgaacctgcgccagcacctggacgcgccg
aacgtcaacatgatcacctgcggcgggcaggccacgatcccgatcgtcttcgccgtcagc
cgcgtcgtcgaggtgccctacgccgagatcgtcgcgtcggtggcgagcgtgtcggcgggc
ccgggcacccgtgccaacatcgacgagttcaccaagaccaccagccggggcgtggagacc
atcggcggcgccaagcggggcaaggcgatcatcatcctcaacccggccgacccgccgatg
atcatgcgcgacaccatcttctgcgctatccccgaggacgccgaccgggacgcgatcgca
cagtcgattcacgacgtcgtcaaagaggtgcagacctacgtgcccggctaccggctgctc
aacgagccgcagttcgacgagccgtcgctcaactccggtggccaggccgtggtcaccacg
ttcgtcgaggtcgagggcgccggcgattatctgcccccgtacgcgggcaacctggacatc
atgaccgccgcggccaccaaggtcggcgaggagatcgccaaggagacgctggccacgacg
gcgggaggagcgcaatga

DBGET integrated database retrieval system