KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0532Help
Entry
MAP0532           CDS       T00156                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpa00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mpa00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:mpa00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation [PATH:mpa00622]
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation [PATH:mpa00621]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
558459..559376
Genome map
AA seq 305 aa AA seqDB search
MPTKAKVAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPQSEGLARARKLGLETTHEGVD
WLLAQPEKPDLVFEATSAYVHRDAAPKYEAAGIRAIDLTPAAVGPAVIPPANLRQHLDAP
NVNMITCGGQATIPIVFAVSRVVEVPYAEIVASVASVSAGPGTRANIDEFTKTTSRGVET
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAQSIHDVVKEVQTYVPGYRLL
NEPQFDEPSLNSGGQAVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKETLATT
AGGAQ
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgccgactaaagcaaaagtggcgattgtcgggtcggggaacatcagcacggacctgctc
tacaagctgctgcgatccgactggctggaaccacgctggatggtcggcatcgacccgcag
agcgagggcctggcccgggcccgcaagctgggcttggagaccacccacgagggggtcgac
tggctgctggcgcagccggagaaacccgacctggtcttcgaggcgaccagcgcttacgtg
caccgcgacgccgcccccaagtacgaggccgccggcatccgggccatcgacctgacgccc
gccgcggtgggcccggccgtcatcccgccggcgaacctgcgccagcacctggacgcgccg
aacgtcaacatgatcacctgcggcgggcaggccacgatcccgatcgtcttcgccgtcagc
cgcgtcgtcgaggtgccctacgccgagatcgtcgcgtcggtggcgagcgtgtcggcgggc
ccgggcacccgtgccaacatcgacgagttcaccaagaccaccagccggggcgtggagacc
atcggcggcgccaagcggggcaaggcgatcatcatcctcaacccggccgacccgccgatg
atcatgcgcgacaccatcttctgcgctatccccgaggacgccgaccgggacgcgatcgca
cagtcgattcacgacgtcgtcaaagaggtgcagacctacgtgcccggctaccggctgctc
aacgagccgcagttcgacgagccgtcgctcaactccggtggccaggccgtggtcaccacg
ttcgtcgaggtcgagggcgccggcgattatctgcccccgtacgcgggcaacctggacatc
atgaccgccgcggccaccaaggtcggcgaggagatcgccaaggagacgctggccacgacg
gcgggaggagcgcaatga

DBGET integrated database retrieval system