KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0790Help
Entry
MAP0790           CDS       T00156                                 

Gene name
fadB_1
Definition
FadB_1
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAP0790 (fadB_1)
   01212 Fatty acid metabolism
    MAP0790 (fadB_1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP0790 (fadB_1)
   00650 Butanoate metabolism
    MAP0790 (fadB_1)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP0790 (fadB_1)
   01040 Biosynthesis of unsaturated fatty acids
    MAP0790 (fadB_1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP0790 (fadB_1)
   00310 Lysine degradation
    MAP0790 (fadB_1)
   00380 Tryptophan metabolism
    MAP0790 (fadB_1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP0790 (fadB_1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP0790 (fadB_1)
   00281 Geraniol degradation
    MAP0790 (fadB_1)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    MAP0790 (fadB_1)
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MAP0790 (fadB_1)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAP0790 (fadB_1)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MAP0790 (fadB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
810274..812421
Genome map
AA seq 715 aa AA seqDB search
MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVERLVAEKDSITGVVITSA
KKTFFAGGDLKSMINLGPENAGEAFDTVEAVKRDLRALETLGKPVVAAINGAALGGGLEI
ALACHHRIAADIKGLVVGLPEVTLGLLPGGGGVTRTVRMFGIQNAFMNILSQGTRFKPDK
AKEIGLVDELVGSVEELVPAAKAWIKANPDAHEQPWDKKGYKMPGGTPSSPALAGILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTASRIESRYFTQLVTGQVAKNMIQAFFF
DLQHINGGGSRPEGIEPVKINKIGVLGAGMMGAGIAYVSAKAGFDVVLKDVSLEAAQKGK
GYSEKLEAKALQRGKTTEEKSKSLLDRITPTADAADFKGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLASGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVAPASIEHAGSQAGYP
APPLQLSDELNLELMHKIAVATRKGIEDAGGTYEPHPAEAVVEKMIEIGRPSRLKGAGFY
EYVDGKRTRLWPGLQETFNSGSTSIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANIG
SIMGIGFPPYTGGSAQFIVGYEGAHGIGKEAFVARAKELAARYGDRFLPPASLTS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaacaccatcaagtgggacaaggacgccgacggcattgtcacgctgacgctc
gacgacccgaccgggtcggccaacgtgatgaacgagcactacaaggaatcgatgcacaac
gccgtcgaacgccttgtggcagagaaggattcgatcaccggtgtggtgatcaccagcgcc
aaaaagacgttcttcgccggcggtgacctcaagagcatgatcaacctcggcccggagaac
gccggtgaggcgttcgacaccgtcgaggccgtcaagcgcgacctgcgcgcgctggagacg
ctcggcaagccggtggtggccgccatcaacggcgcggcgctgggcggcgggctggagatc
gcgctggcctgtcaccaccggatcgccgcggacatcaaggggctggtcgtcggcctgccc
gaggtgaccctgggcctgctgcccggcggcggcggggtgacccgcaccgtgcggatgttc
ggcatccagaacgcgttcatgaacatcctgagccagggcacccggttcaagccggacaag
gccaaggagatcggcctggtcgacgagctggtcggcagcgtcgaggaactggtgcccgcc
gccaaggcgtggatcaaggccaaccccgacgcccacgaacagccttgggacaaaaagggt
tacaagatgcctggcggcaccccgtccagccccgcgctggccggcatcctgccgtcgttt
ccggcgctgctcaagaagcagctcaagggcgccccgatgcccgcaccgcgtgccatcctg
gacgcggccgtcgagggcgctcaggtggacttcgacaccgccagccgcatcgagagccgc
tacttcacccagctggtcaccggccaggtcgccaagaacatgatccaggcgttcttcttc
gacctccagcacatcaacggcggcggctcccgccccgagggcatcgagccggtcaagatc
aacaagatcggtgtgctcggcgcgggcatgatgggcgccggcatcgcctacgtctcggcc
aaggccggcttcgacgtggtgctcaaggacgtcagcctcgaggccgcccagaagggcaag
ggctactcggaaaagcttgaggccaaagcacttcagcggggcaagaccaccgaggagaag
agcaagtcgctgctggaccgcatcaccccgacggccgacgccgccgacttcaagggcgtc
gacttcgtgatcgaggcggtgttcgagaaccaggaactcaagcacaaggtcttccaggag
atcgaggacatcgtcgagcccaacgcgctgctcggctccaacacctcgacgctgccgatc
accggtctggccaccggcgtcaagcggcaggaggacttcatcgggatccacttcttctcc
ccggtcgacaagatgccgctggtcgaaatcatcaagggcgagaagacttccgacgaggcg
ctggcccgcgtgttcgactacacgctggccagcggcaagaccccgatcgtggtcaacgac
agccgcggcttcttcaccagccgcgtcatcggcaccttcgtcaacgaggcgctggccatg
ctcggtgagggcgtggcgccggccagcatcgagcacgccggctcgcaagccggctacccg
gcgccgccgctgcagctgtccgacgagctcaacctggagctgatgcacaagatcgccgtc
gccacccgcaagggcatcgaggacgccggcggcacctacgagccgcaccctgccgaggcg
gtcgtcgagaagatgatcgaaatcggccggccgtcgcggttgaagggcgccggcttctac
gagtacgtggacggcaagcgcacccgcttgtggcccggcctgcaggagacgttcaactcc
ggcagcaccagtattccgttgcaggacatgatcgatcggatgctgttcgccgaggcgctg
gagacgcagaagtgcctggacgagggggtgctcacctccaccgccgacgcgaacatcggc
tcgatcatgggcatcggcttcccgccgtacaccggtggtagcgcgcagttcatcgtcggc
tacgagggtgcacacgggatcggcaaggaggccttcgtggcccgggccaaggagctggcc
gcccgctacggcgaccgcttcctgccgccggcgtcgctcaccagctag

DBGET integrated database retrieval system