KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0840Help
Entry
MAP0840           CDS       T00156                                 

Gene name
echA6
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAP0840 (echA6)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP0840 (echA6)
   00650 Butanoate metabolism
    MAP0840 (echA6)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP0840 (echA6)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP0840 (echA6)
   00310 Lysine degradation
    MAP0840 (echA6)
   00360 Phenylalanine metabolism
    MAP0840 (echA6)
   00380 Tryptophan metabolism
    MAP0840 (echA6)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP0840 (echA6)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP0840 (echA6)
   00281 Geraniol degradation
    MAP0840 (echA6)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP0840 (echA6)
   00627 Aminobenzoate degradation
    MAP0840 (echA6)
   00930 Caprolactam degradation
    MAP0840 (echA6)
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAP0840 (echA6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
859339..860070
Genome map
AA seq 243 aa AA seqDB search
MIGVTRAEAVLTIELQRPERRNALNSQLVEELREAVLKAGDGSTRAIVLTGQGTVFCAGA
DLSGDAFAADYPDRLIELHKVLDATPIPVIGAINGPAIGAGLQLAMQCDLRVVSPDAFFQ
FPTSKYGLALDNWSIRRLSTLVGHGRARAMLLAAEKLTADVALQTGMANRIGTLADAQAW
AAEIAGLAPLAIAHAKRVLNDDGAIEEAWPLHKELFDKAWGSQDVIEAQVARIEKRPPKF
QGA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtgttacccgggccgaagccgttttgaccatcgagctgcagcgccccgagcgc
cgcaacgccctgaactcccagctcgtcgaggagctgcgggaggccgtgctgaaggcgggc
gacggctccacccgcgcgatcgtgctgaccggccagggcacggtgttctgcgccggcgcc
gacctgagcggcgacgcgttcgccgcggactaccccgaccggctgatcgagctgcacaag
gtgctggacgccacgccgatcccggtgatcggcgccatcaacggcccggccatcggcgcc
ggactgcaactggccatgcaatgcgacctgcgggtcgtgtcgccggacgcgttcttccag
ttcccgacgtcgaaatacggcctggcccttgacaactggagcatccggcggctgtcgacg
ctggtcggccacgggcgggcgcgggccatgctgctggccgcggagaagctgaccgccgac
gtggcgctgcagaccgggatggccaaccgcatcgggacgctggccgacgcgcaggcctgg
gccgccgagatcgcgggcctcgcgccgctggccatcgcgcacgccaagcgggtgctcaac
gacgacggcgccatcgaagaggcctggccattgcacaaggaactgttcgacaaggcctgg
ggcagccaggacgtcatcgaagcccaggtcgcccgaatagagaagcggccgccgaagttc
cagggggcctga

DBGET integrated database retrieval system