KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0905Help
Entry
MAP0905           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAP0905
Enzymes [BR:mpa01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     MAP0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
934351..935742
Genome map
AA seq 463 aa AA seqDB search
MTSPSNLPRTVGELRAAGHRERGVKQEIRENLLARLAEGGDGEAIWPGILGFDDTVLPQL
ERALIAGHDFVLLGERGQGKTRLLRALVGLLDEWTPVIAGAELGEHPYSPITPESIRKAA
TLGDDLPVEWKHRSERYTEKLATPDTSVADLVGDIDPIKVAEGRSLGDPETIAYGLIPRA
HRGIVAVNELPDLAERIQVSMLNVMEERDIQVRGYTLRLPLDVLVVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPLELSAEVGVIAQEAHLSAHVPDYLMQIIARFARYLRESNSVDQ
RSGVSARFAIAAAETVAAAARHRGAVLGETDPVARVVDLGTVIDVLRGKLEFESGEEGRE
QAVLEHLLRRATADTASRVLGGIDVGSLVAAVEGGSAVTTGERVSAKDVLAAIPSLPVVD
KIADKLHARSEGERAAALELALEALYLAKRIDKVSGEGQTVYG
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtcaccgagcaacctgccccgcaccgtcggcgaattgcgtgccgccggacatcgt
gaacggggagtcaagcaggaaatccgcgagaatctgctggcccgcctcgccgaaggcggc
gacggtgaggccatctggccgggcatcctgggattcgacgacaccgtcctgcctcagctg
gagcgggcgctgatcgccggccacgacttcgtgctgctcggtgagcgcggccagggcaag
acccggctgctgcgcgcgctggtcggcctgctcgacgagtggacgcccgtgatcgccggg
gccgaactgggcgagcacccgtattcgccgatcacgccggagtccatccgcaaggccgcc
acgctgggtgacgacctcccggtggagtggaagcaccgcagcgagcgctacaccgaaaaa
ctggccaccccggacaccagcgtcgccgacctggtcggcgacatcgacccgatcaaggtc
gccgagggccgcagcctcggggacccggagaccatcgcctacgggctgatcccgcgggca
caccgcggcatcgtcgccgtcaacgagctccccgacctcgccgagcgcatccaggtgtcg
atgctcaacgtgatggaggaacgcgacatccaggtccgcggctacacgctgcggctcccg
ctggacgtgctggtggtggccagcgccaacccggaggactacaccaaccggggccgcatc
atcaccccgctcaaggaccgcttcggcgccgagatccgcacccactacccgctcgagttg
tccgcggaagtcggcgtgatcgcgcaggaagcgcacctgtccgcccacgtccccgactac
ctgatgcagatcatcgcgcggttcgcgcgttacctgcgcgagtccaactccgtcgaccag
cggtccggagtgtcggcgcggttcgcgatcgcggccgccgaaaccgtcgcggccgcggcc
cggcaccgcggcgccgtgctgggcgagacggatccggtggcccgggtcgtcgacctgggc
acggtgatcgacgtgctgcgcggcaagctggaattcgagtccggcgaggaaggccgcgaa
caggcggtgctcgagcacttgctgcgccgcgcgaccgccgacaccgcgtcgcgggtgctg
ggcggcatcgacgtcgggtcgctggtggccgccgtcgagggcggctcggcggtgacgacg
ggtgagcgggtgtcggccaaggatgtgctggcggcgatccccagcctgccggtggtggac
aagatcgccgacaagctgcacgcccgctcggagggcgaacgcgccgcggcgctcgaactt
gcgctggaggcactgtatttggccaagcgaatcgacaaggtgtccggggagggccagacc
gtctatggctaa

DBGET integrated database retrieval system