KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0924Help
Entry
MAP0924           CDS       T00156                                 

Gene name
galU
Definition
hypothetical protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MAP0924 (galU)
   00052 Galactose metabolism
    MAP0924 (galU)
   00500 Starch and sucrose metabolism
    MAP0924 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MAP0924 (galU)
Enzymes [BR:mpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MAP0924 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
955180..956088
Genome map
AA seq 302 aa AA seqDB search
MSCPNVVVPRTAIVPAAGLGTRFLPATKTVPKELLPVVDTPGIELVAAEAAEAGAERLVI
VTSEGKDGVVAHFVEDLVLESTLEERGKTAMLDKVRRAPRLIKVESVVQSEPLGLGHAIG
CVEPRLADDEDAVAVLLPDDLVLPTGVLGTMSKVRAHYGGTVLCAIEVTPEEISAYGVFD
VEPVPDDDPDVLRVKGMVEKPKAEDAPSMFAAAGRYVLDRAIFDALRRIDRGAGGEVQLT
DGIALLISEGHPVHVVVHRGSRHDLGNPGGYLKAAVDFALDRDDYGPDLRQWLVARLGLS
EQ
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcatgcccaaacgtggtggtgccacgcacggcgattgtgcccgccgccggccttggt
acccgattcctgcccgcgaccaagacggtccccaaagagctgctgcccgtggtcgatacc
cccgggatcgagctcgtcgccgccgaggcggccgaggccggcgccgaacgcctggtgatc
gtcacctcggagggcaaggacggtgtcgtcgcgcacttcgtcgaggacctggtgctcgag
agcacgctggaggagcgcggcaaaaccgcgatgctggacaaggttcggcgggcgccgcgg
ctgatcaaggtcgagtcggtggtgcagagcgagccgctgggcctgggccacgcgatcggg
tgtgtggaaccgcggctggccgacgacgaggacgcggtcgcggtgctgctgcccgacgac
ctggtgttgccgaccggtgtgctggggaccatgtcgaaggtgcgggcgcactacggcggc
acggtgttgtgcgccatcgaggtgacgcccgaggagatcagtgcctacggcgtcttcgac
gtcgagccggtgcccgacgacgatccggacgtgctgcgggtcaagggcatggtcgagaag
ccgaaggccgaggacgcgccgtcgatgttcgccgcggcgggccgctacgtgctcgaccgc
gccatcttcgacgcgttgcgccgcatcgaccgcggcgccggcggcgaggtccagctgacc
gacgggatcgcgctgctgatctccgagggccacccggtgcacgtggtcgtgcaccgcgga
tctcgacacgacttgggaaatcctggcggctacctcaaggctgcggttgactttgcattg
gaccgtgacgactacggcccggatttgcggcagtggttggtggcgcggttaggcctgtcc
gagcagtaa

DBGET integrated database retrieval system