KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP0976Help
Entry
MAP0976           CDS       T00156                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:mpa00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1014056..1015006
Genome map
AA seq 316 aa AA seqDB search
MSDGNTAAAWVPTGSVTVRVPGKVNLYLAVGDRREDGYHELTTIFQAVSLLDEVTVRNAD
VLSLDIVGEGADKLPTDERNLAWQAAELMADHVGRAPDVSIMIDKSIPVAGGMAGGSADA
AAVLVAMNSLWELNVPRRDLRMLAARLGSDVPFALHGGTALGTGRGEELATVLSRNTFHW
VLAFADGELLTRKVFAELDRLRRAGDPPRLPGPGPVLAALAAGDADQLAPLLGNEMQAAA
VSLNPGLRRTLRAGVQAGALAGIVSGSGPTCAFLCPSAAAAVDVGTEVSGVGVCRTVRVA
SGPVAGARVVPAPTEV
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacggcaacaccgccgcggcttgggtgcccaccgggtcggtcaccgtccgggtg
cccggaaaagtcaacctctacctggccgtcggcgatcgccgcgaggacggctaccacgag
ctgaccacgatttttcaggccgtctcgctgctcgacgaggtgaccgtgcgcaacgccgac
gtgctctcgctcgacatcgtcggcgagggcgccgacaaactgcccaccgacgaacgcaac
ctggcctggcaggccgccgagctgatggccgaccacgtcggccgggcgccggacgtgtcg
atcatgatcgacaagtccattccggtggccggcgggatggccggcggtagcgccgacgcg
gcggcggtgctggtcgcgatgaactcgctgtgggagctcaacgtgcctcgccgcgatctg
cgcatgctcgccgcgcggctgggcagcgacgtgccgtttgcgttgcacggcggcaccgcg
ctgggcaccggccgcggcgaggagctggcgacggtattgtcccgcaacacctttcactgg
gtgctggcgttcgccgacggcgagctgctgacccgcaaggtgttcgccgagctggaccgg
ctgcggcgcgcgggcgatccgccgcggctgcccgggccgggcccggtgctggccgcgctg
gccgccggcgacgccgaccagttggcgccgctgttgggcaatgaaatgcaggccgccgcg
gtgagcctgaatcccggcctgcgccgcaccctgcgcgccggcgtgcaggccggcgcgctg
gcgggcatcgtgtcgggctccggcccgacgtgtgccttcctgtgcccgtcggcggccgcg
gcggtggacgtcggcaccgaggtgtccggggtgggggtgtgccgcacggtgcgggtcgcc
agcggaccggtggccggtgcccgcgtggtcccggcaccgaccgaggtgtga

DBGET integrated database retrieval system