KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1037Help
Entry
MAP1037           CDS       T00156                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MAP1037 (ruvA)
Enzymes [BR:mpa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MAP1037 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1081852..1082451
Genome map
AA seq 199 aa AA seqDB search
MIASVRGEVLEVALDHAVIEAAGVGYRVNATPSTLSTLRTGTQARLITAMIVREDSMTLY
GFTDAETRDLFLTLLSVSGVGPRLAMATLAVHDAGALRQALHDGDVAALTRVPGIGKRGA
ERMVLELRDKIGAAGAAGAPAGAARNGHAVRGPVVEALVGLGFAAKQAEEATDKVLAAEP
EAGTSGALRAALSLLGKSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcctcggtgcgcggcgaggtgctcgaggtggcgctcgaccatgccgtgatcgag
gccgccggggtcggctaccgggtcaacgcgacgccctcgacgctgtccacgctgcgcacc
gggacgcaggcccggctgatcaccgcgatgatcgtccgcgaggattcgatgacgttgtac
ggcttcaccgacgccgagacccgtgatttgttcctgaccctgctgtcggtgtcgggcgtc
ggcccgcggctggcgatggcgacgctggccgtgcacgacgccggcgcgctgcgccaggcc
ctgcacgacggcgacgtcgccgcgctgacccgggtgcccgggatcggcaagcgcggcgcc
gagcggatggtgctggagctgcgcgacaagatcggcgcggccggggccgcgggcgcgccg
gcgggcgcggcccgcaacggccacgcggtgcgcggcccggtggtcgaggcgctggtcggt
ctcggcttcgccgccaagcaggccgaggaggccaccgacaaggtgctggccgccgagccc
gaagccggcacctccggcgcgctgcgcgccgccctgtcgctgctggggaagtcccgatga

DBGET integrated database retrieval system