KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1115Help
Entry
MAP1115           CDS       T00156                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mpa00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1167190..1168146
Genome map
AA seq 318 aa AA seqDB search
MTRHLLAAGDLSRDDATAILDDADRFAQALVGREIKKLPTLRGRTVVTMFYENSTRTRVS
FEVAGKWMSADVINVSAAGSSVGKGESLRDTALTLRAAGADALIIRHPASGAAHLLAEWT
CGNGDSSDAGPSVINAGDGTHEHPTQALLDALTIRQRLGGIEGRRVVIVGDVLHSRVARS
NVMLLSTLGAEVVLVAPPTLLPVGVEGWPVTVSNDFDAELPAADAVLMLRVQAERMNGGF
FPSVREYSSLYGLSDRRQAMLPGHAVVLHPGPMLRGMEIASSVADSSQSAVLQQVSNGVH
VRMAVLFHVLVGAEEIAA
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgacccgccacctgctcgccgccggcgacctgagccgcgacgacgccaccgccatcctc
gacgacgccgaccggttcgcccaggcgctggtgggccgcgagatcaagaaactgccgacg
ctgcgtggccgcaccgtcgtcaccatgttctacgagaactccacccgcacccgggtgtcc
ttcgaggtggccggcaagtggatgagcgccgacgtgatcaacgtcagcgccgccgggtcc
tcggtgggcaagggggagtcgctgcgcgacaccgccctgacgctgcgggcggccggcgcc
gacgcgctgatcatccggcacccggcctccggcgccgcgcacctgcttgccgaatggact
tgcggcaacggcgattccagcgacgccgggccgtcggtgatcaacgccggcgacggcacc
cacgagcacccgacgcaggcgctgctggacgcgctgaccatccgccagcggctcggcggc
atcgagggccggcgcgtggtgatcgtcggcgacgtcctgcacagccgggtggcccgctcc
aacgtgatgctgctgtccaccctgggcgccgaggtggtgctggtcgccccgccgacgctg
ttgccggtcggcgtcgagggctggccggtgaccgtgtcgaacgacttcgacgccgagctg
cccgccgccgatgcggtgctcatgctgcgcgtgcaggccgagcggatgaacggtggcttc
ttcccgtcggtgcgcgagtactcgtccctgtacgggctgtccgatcgccgccaggcgatg
ctgcctggccacgccgtggtgctgcacccgggcccgatgctgcgcggcatggagatcgcc
tcctcggtggcggactcgtcgcaatcggctgtgctgcaacaggtttccaatggtgtgcac
gtgcggatggcggtgctgttccacgtgctggtgggcgcggaggagatcgccgcatga

DBGET integrated database retrieval system