KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1123Help
Entry
MAP1123           CDS       T00156                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MAP1123 (gmk)
Enzymes [BR:mpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MAP1123 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1176608..1177279
Genome map
AA seq 223 aa AA seqDB search
MTADGGPDVRHGTRPEPSGDGRVVVLSGPSAVGKSTVVRCLRERVPNLHFSVSATTRAPR
PGEVDGVDYHFVSPARFQQLIDEGALLEWAEIHSGLHRSGTLAAPVRAAVARGCPVLIEV
DLAGARAVKKAMPEALTVFLAPPSWEDLEARLIGRGTETPEVIARRLQTARVEMAAQHDF
DRVVVNSRLESACAELVSLLVGTAPDRHDTSGRTGRQTTSHPD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgactgccgacgggggaccggacgtccggcatgggacgcgtcccgaaccatcaggtgac
ggacgtgtggtcgtgctgtccggtccctccgcggtcggcaaatcgacagtggttcggtgc
ctgcgcgagcgggtccccaacctgcatttctccgtctcggccacgacgcgggcaccgcgg
ccgggcgaggtcgacggcgtcgactaccacttcgtcagccccgcccgattccagcagctc
atcgacgagggcgcgctgctggagtgggccgaaatccactccgggctgcaccggtcgggc
accctggccgcgccggtgcgggccgccgtcgcgcggggctgcccggtgctgatcgaggtc
gacctggccggcgcccgggcggtgaagaaggcgatgcccgaggcgctcaccgtgttcctg
gccccgcccagctgggaggacctggaggccaggctgatcggccggggcaccgaaaccccg
gaggtcatcgcccggcgcctgcagaccgcccgcgtcgaaatggcggcccaacacgacttc
gaccgggtggtggtcaacagtcgattggagtctgcctgcgccgaattggtatccttgctg
gtgggaactgcgccggaccggcacgatacgtctggccggaccgggcgccagaccacctcc
catcccgattga

DBGET integrated database retrieval system