KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1166Help
Entry
MAP1166           CDS       T00156                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAP1166 (tpiA)
   01230 Biosynthesis of amino acids
    MAP1166 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP1166 (tpiA)
   00051 Fructose and mannose metabolism
    MAP1166 (tpiA)
   00562 Inositol phosphate metabolism
    MAP1166 (tpiA)
Enzymes [BR:mpa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MAP1166 (tpiA)
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MAP1166 (tpiA)
  Exosomal proteins of bladder cancer cells
   MAP1166 (tpiA)
  Exosomal proteins of melanoma cells
   MAP1166 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1224167..1224952
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHFEAIALVQKIAFALPDKYYDKVDVTVLPPFTDLRSVQTLVDGD
KLRLSYGAQDLSQHDSGAYTGDISGAFLAKLGCTFVVVGHSERRTYHNEDDALVAAKAAT
ALKHELTPIICIGEHLEVREAGNHVIHCEEQLRGSLAGLSAEQIGKVVIAYEPVWAIGTG
RVASASDAQEVCAAIRKELASLASAQIADSVRVLYGGSVNAKNVGELIAQDDIDGGLVGG
ASLDGEQFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatcgccggcaactggaagatgaacctcaaccacttcgaggcc
atcgcgctggtgcaaaagatcgcgttcgcgctgccggacaagtactacgacaaggtggac
gtcacggtgctgccgccgttcaccgacctgcgcagcgtgcagaccctggtcgacggcgac
aagctgcggctcagctacggcgcccaggacctgtcccagcacgactcgggcgcctacacc
ggcgacatcagcggcgccttcctggccaagctgggctgcacgttcgtcgtcgtcgggcac
tcggagcggcgcacctaccacaacgaggacgacgcgctggtggccgccaaggccgcgacc
gcgctcaagcacgagctgaccccgatcatctgcattggcgagcacctcgaggtccgcgag
gcgggcaaccacgtcatccactgcgaggagcagctgcgcggctcgctggccgggctgtcc
gccgagcagatcggcaaggtcgtcatcgcctacgagccggtgtgggcgattggaaccgga
cgggtggccagtgcgtccgatgctcaagaggtgtgcgcggcgatccggaaagagttggcg
tcactcgcctcggcgcagatcgccgactcggtgcgggtgctctacggcggctcggtgaac
gcgaagaacgtcggggagctgatcgcccaggacgacatcgacggcggcctggtgggcggc
gcgtcgctggacggcgagcagttcgccacgctggccgccatcgccgccggcgggccgctg
ccgtga

DBGET integrated database retrieval system