KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1293Help
Entry
MAP1293           CDS       T00156                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mpa00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1382135..1383577
Genome map
AA seq 480 aa AA seqDB search
MYRPDIDLSSSGTMDTVSPTPASPMAGIDLRGAELTAARLRSALPRGGADVETVLPKVRP
IVQAVAERGADAALEFGASFDGVRPAAVRVPEAALDKALADLDAAVADALRVMIDRARAV
HADQRRTDVTTTLGPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVASLV
VASPPQAQFDGLPHPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTGAEWPGFSSDRA
RSASSPGADAELVPVDMITGPGNIYVTAAKRLCRSRVGIDAEAGPTEIAILADHTADPAH
VAADLISQAEHDEMAGSVLVTPSEDLAAATDAELAAQLPTTVHRERVTAALGGRQSAIIL
VDDLDAGITVVNAYAAEHLEIQTADAAAVAGRIRAAGAVFVGPYSPVSLGDYCAGSNHVL
PTAGSARHSSGLSVQTFLRGIHVVDYTEAALKDVSGHVITLAQAEDLPAHGEAIRRRFER
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ctgtaccggccggatatcgacttgagttcctctgggacaatggacaccgtgagtcccacc
ccggcgtcaccgatggccggcatcgacctgcggggcgccgagctgaccgctgcccgattg
cggtcggcgctgccgcgcggcggcgccgacgtggagacggtgctgcccaaggtgcgaccc
atcgtgcaggcggtggccgagcgcggcgccgacgccgcgctggagttcggcgcctccttc
gacggtgtccgcccggcggcggtccgggtgccggaggcggcgctggacaaggccctggcc
gacctggacgcggccgtcgcagacgccctgcgggtgatgatcgaccgcgcccgcgccgtg
cacgccgaccagcgccgcaccgacgtcaccaccacgctgggaccgggcgcgacggtgacc
gagcgctgggtgccggtcgagcgggtgggcctgtacgtgcccggcggcaacgccgtctac
ccgtccagcgtggtgatgaacgtggtgcccgcccaggccgccggcgtcgcgtcgctggtg
gtggccagcccgccgcaggcccagttcgacgggctgccgcatccgaccatcctggccgcg
gcccggctgctgggcgtcgacgaggtgtgggcggtcggcggcgcgcaggcggtggcgctg
ctggcctacggcgggaccgataccggggccgaatggcccggcttctcctcggatcgcgca
cgatccgcatcgtcgccgggggcagacgccgagctggtgccggtcgacatgatcaccggg
ccgggcaacatctacgtcaccgccgccaagcggctgtgccggtcgcgggtcggcatcgac
gccgaggccgggccgaccgagatcgcgatcctggccgaccacaccgccgaccccgcgcac
gtggccgccgacctgatcagccaggccgagcacgacgagatggccggcagcgtgctggtc
acccccagcgaggacctggccgcggccaccgacgcggaactggccgcccagctgccgacc
accgtgcaccgcgagcgggtgaccgccgcgctgggcggacgccagtcggcgatcatcctg
gtcgacgacctggacgccgggatcacggtcgtcaacgcctacgccgccgagcacctggag
atccagaccgccgacgcggcggccgtggccggccggatccgcgcggccggagccgttttc
gtcggcccgtactcgccggtcagcctgggcgactactgcgccggctccaatcacgtcctg
cccaccgcgggcagcgcccggcattccagcggcctgtcggtgcagaccttcttgcgcggc
atccacgtcgtcgactacaccgaggcggcgctgaaagacgtgtccgggcacgtgatcacc
ctggcgcaggccgaagacctgccggcgcacggcgaggcgatacggcggaggttcgagcgg
tga

DBGET integrated database retrieval system