KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1306Help
Entry
MAP1306           CDS       T00156                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAP1306 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAP1306 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAP1306 (trpB)
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MAP1306 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1393571..1394836
Genome map
AA seq 421 aa AA seqDB search
MDISPRTRPDLPLPSAAIAEPTRHEPDAGGHFGVYGGRYVAEALMAVIEEVTTAYEKERV
NQDFLDTLDYLQANYAGRPSPLYEAPRLSEQAGARIFLKREDLNHTGSHKINNVLGQALL
AQRMGKKRVIAETGAGQHGVATATACALLGLECVIYMGAVDTERQALNVARMRLLGATVV
SVQSGSKTLKDAINEAFRDWVTNADNTFYCFGTAAGPHPFPAMVRDFQRIVGLEARAQIQ
AQAGRLPDAVVACIGGGSNAIGIFHPFIDDPGVRLVGFEAAGDGVETGRHAATFSGGSPG
AFQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLRETGRAEYRPITDAEAMEAFR
VLCRTEGIIPAIESAHAVAGALKLGPELGRGAIIVVNLSGRGDKDVETAAKWFGLLGSSD
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtggacatctccccccggacccgtccggaccttccgcttccgagcgcagcgatcgccgaa
cccacccgtcatgaacccgacgccggtgggcatttcggcgtgtacggcggccgttacgtc
gcggaggcgctgatggccgtcatcgaagaggtcaccaccgcctacgagaaggagcgcgtc
aaccaggatttcctggacacgctggactatctgcaggcgaactacgccgggcggccgtcg
ccgttgtacgaggccccgcggctgtccgagcaggccggcgcgcggatcttcctcaagcga
gaagacttgaaccacaccggttctcacaagatcaacaacgtgctcggtcaggcgttgctg
gcccagcggatgggcaagaagcgggtgatcgccgagaccggggccggccagcacggcgtg
gccaccgccacggcctgcgccctgctgggcctggaatgcgtgatctacatgggtgcggtg
gacaccgagcgccaggcgctcaacgtggcgcggatgcgcctgctgggtgcgacggtcgtc
tcggtgcagagcggttcgaaaacgctcaaggacgccatcaacgaagccttccgggactgg
gtcaccaacgccgacaacaccttctactgcttcggcaccgcggccgggccgcaccccttc
ccggccatggtccgcgatttccagcgcatcgtcgggctggaggcccgcgcccagatccag
gcgcaggcgggccggctgcccgacgcggtggtggcctgcatcggcggcggctccaacgcc
atcgggatcttccatccgttcatcgacgaccccggcgtgcggctggtgggattcgaggcg
gccggtgacggcgtcgaaaccggaaggcacgccgcgactttcagcggcggctcgcccggg
gcgttccaggggtcgttctcctacctgctgcaggacgaagacgggcagaccatcgaatcc
cattccatctcagcgggtctcgactatcccggagtcggtccagaacatgcgtatctgcgc
gagaccggccgtgccgaataccgtccgatcaccgacgccgaggcgatggaagcgtttcgg
gtgctgtgccgcaccgaggggatcatcccggccatcgagtccgcgcacgccgtggcgggt
gcgctgaagttggggcccgagctaggtcgcggcgcgatcatcgtggtgaacctgtccggg
cgcggggacaaggacgtcgagacggcggcaaagtggttcgggctgttggggtccagcgac
cgatga

DBGET integrated database retrieval system