KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1328cHelp
Entry
MAP1328c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mpa03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1420827..1421615)
Genome map
AA seq 262 aa AA seqDB search
MPELPDVEGFRRQLADALPGRRVRRVKVHDPGILRNTTATTLARRLTGRRFAGPRRHGKW
LVLPTDGPTLLIHSGMTGRPYYCADGAAEDRHQRLVVSLDQGELRYTDLRKLRGVWLADD
PDDLVPITGRQGPDALGLGLRDFRDALTARSARRRQLKSALMDQSVLAGLGNLLVDEICW
RARIRPTRAVADLDDDEVKALHRAMTQVLRTAVRHGRVPGLPRWLTGARDAPDPHCPRCG
GRLDHARVGGRTTLWCPRCQPG
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgccggaactgcccgacgtggagggattccggcggcaactggccgacgcgttgccgggg
cgacgcgtccggcgggtgaaggtgcacgatcccgggatcctgcgcaacaccaccgcgacg
acgctggcccgccggctgaccgggcggcggttcgccggcccgcgacgacacggcaagtgg
ctggtgcttcccaccgacggcccgacgctgctgatccacagcggaatgaccggccgcccc
tactattgcgccgacggtgccgccgaggaccgccaccagcgcctcgtggtgtcgctggac
cagggcgaactgcgctacaccgatcttcgtaaattgcggggagtctggctggccgacgat
cccgacgatctggtgcccatcaccggccggcaaggccccgacgcgctgggtcttggcctg
cgcgatttccgcgacgcgctgacggcgcgctcggcccggaggcggcagctcaaatccgcg
ctgatggaccagtcggtgctcgccgggctgggcaacctgctggtcgacgagatctgctgg
cgggcccggatccgccccacccgcgcggtcgcggacctggacgacgacgaggtgaaggcg
ctgcaccgggcgatgacgcaggtgctgcgcaccgcggtgcggcatggccgggtgccgggc
ttgccgcgctggctcaccggcgcccgcgacgcgcccgacccgcactgcccccgctgcggc
ggccgcctggaccacgcccgggtgggcggccggaccaccctgtggtgcccgcgctgtcag
cccgggtaa

DBGET integrated database retrieval system