KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1409cHelp
Entry
MAP1409c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAP1409c
Enzymes [BR:mpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     MAP1409c
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MAP1409c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1522440..1523144)
Genome map
AA seq 234 aa AA seqDB search
MAAGVQNITTTGQIGDGREAAAVEYVLRNARAGDIDDVLATIDRFAYQKSMLINVGDEKG
LILDAAVRRADPDVALELGTYCGYGALRIARAAPGARVFSVELADANAANARRIWAHAGV
ADRVTCVVGTIGDGGRTLDVLANEHGFAAGTLDFVFLDHDKDAYLADLKSIMDRGWLHPG
SIVVADNIRWPGSPKYREYMHVQQGKRFDTVEHKTHAEYQTMLSDLMLESEYLG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggcggccggggtgcagaacatcaccaccaccggccagatcggtgacggacgggaagcg
gccgccgtcgagtacgtgctgcgcaacgcgcgggccggcgacatcgacgacgtgctggcc
accatcgacaggttcgcctaccagaaatcgatgctgatcaatgtcggcgacgagaagggg
ctgatcctcgacgccgcggtgcgccgcgccgacccggacgtggcgctggagctgggcacc
tactgcggctacggcgcgttgcggatcgcccgggccgccccgggcgcccgggtgttctcg
gtcgaactggccgacgccaacgccgccaacgcccgccggatctgggcgcacgccggcgtc
gccgaccgggtgacctgcgtggtgggcaccatcggcgacggcgggcgcaccctggacgtc
ctggccaacgagcacggattcgctgccggcacactggatttcgtgtttctcgatcacgac
aaggacgcctacctggccgacctgaagagcatcatggaccggggctggctgcatccgggc
tcgatcgtcgtcgccgacaacatccgctggccgggctcgccgaagtaccgcgagtacatg
catgtccagcagggcaagcggttcgacaccgtcgagcacaagacgcatgccgagtaccag
accatgctctccgacctgatgctggagtccgaatacctgggctga

DBGET integrated database retrieval system