KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1421Help
Entry
MAP1421           CDS       T00156                                 

Gene name
asnB_1
Definition
AsnB_1
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mpa00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1551687..1553492
Genome map
AA seq 601 aa AA seqDB search
MCGVTGEVRLDGRAPDVAAVSAMAAVLTPRGPDAGGAWSQGRVALGHRRLKIIDLTEAGA
QPMVDSELGLSIAWNGCIYNYKELRSELSGYGYRFFSHSDTEVLIKAYHRWGDDFVSHLF
GMFAFAIVERDSGRVLLGRDRLGIKPLYLTEDSHRVRFASTLPALLAGGGVDTRIDPVAL
HHYMSFHSVVPAPATILRGVRKVPPASLVAIEPDGKRTVTTYWAPDFTRHADRADWSERD
WEDAVLSTLRLAVKRRLVADVPVGCLLSGGVDSSLIVGLLAEAGQHGLSTFSIGFESAGG
VKGDEFQYSDIVAQRFETNHHQIRIDSDRMLPALDGAIGAMSEPMVSHDCVAFYLLSQEV
ARHVKVVQSGQGADEVFAGYHWYPPMGEPAAATLDGAVAQYRRAFFDRDTAGVAQLVGPG
ILAPGDPSLRFVTEHFAQAGAETGIDRALRLDTTVMLIDDPVKRVDNMTMAWGLEGRVPF
LDHELVELAATCPPEYKIAHEGKGVLKQAARRVIPSEVIDRPKGYFPVPALTHLEGPYLD
MDRDALYAPTAKERGLFNTDAVDALLANPNGKLTPLRGNELWQIALLELWLQRHGVTGPV
A
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggagtcaccggggaggtacgactcgacgggcgggcgcccgatgtagccgcggtc
tcggcgatggccgccgtgctgacaccacgcggccccgacgccggcggcgcctggtcgcag
ggccgcgtcgcgctcgggcatcgtcgcctcaagatcatcgacctgaccgaagccggcgcc
cagccgatggtcgactccgagctgggcctatccatcgcctggaacggctgcatctacaac
tacaaggaactgcgcagcgagctgtccggctacggctaccggttcttctcgcacagcgac
accgaggtcctgatcaaggcctaccaccggtggggcgacgacttcgtcagccatctgttc
ggcatgttcgccttcgccatcgtcgaacgcgacagcggtcgggtgctgctcggccgcgac
cgcctcggcatcaaacccctctacctgaccgaggacagtcaccgggtccggttcgcctcg
acgctgcccgcgctgctggccggcggcggcgtggacacccgcatcgacccggtcgccctg
caccactacatgagcttccactcggtggtgcccgccccggccaccatcctgcgcggggtc
cgcaaggtgccgcccgcctcgctggtcgccatcgagcccgacggcaaacgcaccgtcacc
acctactgggcgcccgatttcacccggcacgccgaccgcgccgactggtccgaacgcgac
tgggaggacgccgtgctgtccaccctgcggctggccgtcaagcgccggctggtggccgac
gtcccggtgggctgcctgctgtccggtggtgtcgactccagcctgatcgtgggtctgctc
gccgaagccggccagcacgggctgtccaccttctccatcggcttcgagtcggcgggcggg
gtgaagggcgacgagttccagtactccgacatcgtggcccagcgcttcgagaccaaccac
caccagatccgcatcgactccgaccggatgctgcccgcgctggacggcgccatcggcgcg
atgagcgaaccgatggtcagccacgactgcgtcgccttctacctgctcagccaggaagtg
gcccggcacgtcaaggtggtgcagtccgggcagggcgccgacgaggtgttcgccggctac
cactggtacccgccgatgggcgagccggccgccgccaccctggacggggccgtcgcccag
taccggcgggccttcttcgaccgggacaccgccggcgtcgcgcagctggtcggacccggc
atcctggccccgggcgaccccagcctgcggttcgtcaccgaacacttcgcccaggccggc
gccgagaccggcatcgaccgcgcgttgcggctcgacaccacggtgatgctgatcgacgac
ccggtgaagcgggtcgacaacatgacgatggcctgggggctggagggccgggtgcccttc
ctcgaccacgagctggtcgagctggccgccacctgcccgccggagtacaagatcgcccac
gaaggcaagggcgtgctcaaacaggctgcgcgacgggtcattccgtccgaggtgatcgac
cggcccaagggctacttcccggtcccggcgctgacccacctggaaggcccctacctggac
atggaccgcgacgcgctgtacgcgccgaccgccaaggaacgcggtctgttcaacaccgac
gcggtcgacgcgctgctggccaaccccaacggcaagctgaccccgctgcgcggcaacgag
ctgtggcagatcgccctgctcgagctgtggctgcagcggcacggtgtgacgggcccggtt
gcatga

DBGET integrated database retrieval system