KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1447cHelp
Entry
MAP1447c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MAP1447c
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other, unknown, acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     MAP1447c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1580159..1581667)
Genome map
AA seq 502 aa AA seqDB search
MDSGTTRGDAHVNTDVTPIPASSITSWDHEADVVIAGYGVAGAAAAVEAARAGADVLVLE
RTGSWGGAAAMAGGFIYLGGGTPIQKACGFTDSVDNMAAFLNVAMGPGADADRIADYCAG
SLAHFEWLVGCGVPFKAEFFGEPGWEPMGDQGLMYSGGENSYPFNTIASPAPRGHVPQMQ
NKKQGEASAGYMLMKPLVETATAAGARALYDVRVQRLITESDGRVVGMRARKYGTEMNIR
ARTGVVLATGSFAYNDSMVARYAPRIAGRPAASIEQHDGQAIRMAQALGADLAHMDATEV
AIFIDPQQLVRGILVNGRGQRYVAEDTYPGRIGQLTLYQQDNTAYLIIDGDAQDEAMASW
SPKLMLRPATWVADTVADLERDMALPPGSLQDTVAAYNAGATRGEDPLLHKKPEWIRPIG
SPVGAVDLRESTGGFTLGGLATTLDAEVLHVSGQPIPGLFAAGRCTAGLAAWGYASGISL
GDGSFYGRRAGASAAGRRLPRV
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggattccggaaccacccgcggcgatgcgcatgtgaataccgacgtcacaccgataccc
gcgtcgtcgatcacctcctgggaccacgaggccgacgtcgtcatcgccggctacggcgtg
gccggtgcggccgcggcggtggaagcggcccgcgccggggccgacgtcctggtgctggag
cgcaccggatcctggggcggcgcggcggcgatggccggcggattcatctacctgggcggc
ggcacgcccatccagaaggcttgtggtttcaccgattccgtcgacaacatggcggcgttc
ctcaacgttgcgatgggcccgggtgccgacgccgaccggatcgccgactactgcgcgggc
agcctcgcccacttcgagtggctggtcggctgcggagtgccgttcaaggcggagttcttc
ggcgagcccggctgggagccgatgggcgatcaggggttgatgtacagcggcggggagaac
tcgtatccgttcaacaccatcgcctcccccgctccgcgcgggcacgtcccgcagatgcag
aacaagaagcagggcgaagccagcgccggctacatgctgatgaagccgctcgtcgagacc
gccaccgccgccggcgcccgcgcgctctacgacgtgcgggtgcagcggctgatcaccgag
tccgacggccgggtcgtcggcatgcgcgcgcgaaagtacggcaccgagatgaacatccgg
gcgcgtaccggcgtggtgctggcgaccggcagcttcgcctacaacgactccatggtggcc
cgctacgcgccgcgcatcgccggacgcccggccgcctcgatcgagcagcacgacgggcag
gcgatccggatggcccaggcgctgggcgccgacctcgcgcacatggacgccaccgaggtg
gcgatcttcatcgatccccagcagttggtgcgcggcatcctggtcaacggccgcggccag
cgctacgtcgccgaggacacctatccgggccggatcgggcaactcaccctctaccagcag
gacaacaccgcctacctgatcatcgacggcgacgcccaggacgaggcgatggcctcgtgg
tcgcccaagctgatgctgcgcccggcgacctgggtggccgacacggtggccgacctggaa
cgcgacatggccctgccgcccggttcgctgcaggacaccgtggccgcctacaacgcgggc
gccacccgcggcgaggatccgctgctgcacaagaagcccgagtggatcaggccgatcggc
tcccccgtcggcgcggtcgacctgcgggaaagcaccggcggcttcaccctgggcgggctg
gccaccacgctggacgccgaggtgctgcacgtcagcgggcagcccatcccgggcctcttc
gcggccggccggtgcaccgccgggctggccgcctggggctacgccagcggcatctcgctc
ggcgacggcagcttctacggccgccgcgccggcgcctcggccgccggtcgtcgcttgccg
cgcgtgtaa

DBGET integrated database retrieval system