KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1500cHelp
Entry
MAP1500c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mpa00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1641241..1643382)
Genome map
AA seq 713 aa AA seqDB search
MTELAPSLIELARRYGIATDYEDWTGRRVRVPETTLTAVLAALGVAAGTEQERNDALTAK
LRAYWARRLPATIVGRTGEQIRFWGHVTHGDPAEVWVRLEDGTVRDGVEQVDNFTPPFDL
DGRWVGEASFVLPTDLPLGYHRVWLRSGGSEASAALIVTPDWLGLPERLGARRAWGLAVQ
LYSVRSRQSWGVGDLTDLTDLAVWSAFRHGADYLLVNPLHAAGFSGPANRMEPSPYLPTS
RRFVNPIYLHVEAIPEFAELTKRSRVRRLRADVQTHAAGLDAVDRDSSWAAKRTALQWLH
QQPRSAGRQLCYAAFRDREGRALDDFATWCALAEEYGPDWHSWPETLQHPDAPGVADFVE
KHSEAVDFHRWLQWQLDEQLAAAQSQAIRAGMSLGIMHDLAVGVHPNGADAWALQDVMAL
GVTAGAPPDEFNQLGQDWSQPPWRPDRLDEHEYRPFRALIRAVLRHAGGVRIDHIIGLFR
LWWIPRGSAPTEGTYVRYDHEAMIGIVALEAHRAGAVVVGEDLGTVEPWVRDYLLLRGLL
GTSILWFELDRDGNGGPLPAERWREYCLSSVTTHDLPPTAGYLAADHVRLRDSLGLLTRP
VADELESDRADLAAWMAELRRVGLLADGETDSEQVILALYRYLGRTPSRLLGVALTDAVG
DRRTQNQPGTTDEYPNWRVPLTGPDGRPVLLEDVFTDRRAAALAEAVRAAIAP
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacagaactcgcgccgtcgctgatcgaactcgcccgcagatacggcatcgcgacggat
tacgaggactggaccggccgccgggtgcgggtgcccgagaccaccctcacggcggtgctg
gccgcgctcggcgtggccgccggcaccgagcaggaacgcaacgacgcgctgaccgccaag
ctgcgcgcgtactgggcgcgccggttgcccgcgaccatcgtcgggcggaccggtgagcag
atccggttctgggggcacgtcacccacggcgatcccgccgaggtgtgggtgcggctggag
gacggcaccgtgcgcgacggcgtcgaacaagtcgacaacttcaccccgccgttcgacctg
gacggccgctgggtcggcgaggcgagcttcgtgctgcccaccgacctgccgctcggctat
caccgggtgtggctgcgctcgggcggatcggaggccagcgccgcgctgatcgtcacgccg
gattggctcggcctgccggaacgcctgggcgcccggcgcgcctggggcctggccgttcag
ctctacagcgtgcggtcccggcagtcctggggcgtcggcgatctcaccgatctcaccgac
ctcgcggtgtggtcggccttccgtcacggcgccgactatctgttggtcaatcccctgcac
gcggccgggttctccggccccgccaaccggatggagccctcgccctacctgccgacctcg
cggcgcttcgtcaatccgatttatcttcacgtcgaggcgatcccggagttcgccgaactg
accaagcgcagccgggtccggcggctgcgcgcggacgtgcaaacgcacgccgccggcctg
gacgccgtcgaccgggacagctcctgggcggccaagcgcacggcgctgcagtggctgcac
caacagccccgctcggcgggccggcaactgtgttacgccgccttccgcgaccgcgagggc
cgggcgctcgacgacttcgccacctggtgcgcgctggccgaagaatacggcccggactgg
cattcctggcccgagacgctccagcacccggacgcccccggggtcgccgatttcgtcgaa
aagcattcggaggcagtcgatttccatcgctggctgcagtggcagctggacgagcagctg
gccgccgcgcagtcccaggcgatccgggccgggatgtcgctgggcatcatgcacgacctg
gccgtcggtgtgcatcccaacggcgccgacgcctgggcgctgcaggatgtgatggcgctg
ggggtgaccgccggcgcgccgccggacgagttcaaccagctcggccaggactggtcgcag
ccgccgtggcgaccggaccggctcgacgagcacgagtaccggcccttccgcgccctgatc
cgcgcggtgctgcgacatgccggcggggtgcgcatcgaccacatcatcgggctgttccgg
ctgtggtggatcccgcgcggcagcgccccgaccgagggcacctacgtgcgctacgaccac
gaggccatgatcggcatcgtcgcgctggaggcgcatcgggccggggcggtggtggtcggc
gaggacctgggcactgtcgagccgtgggtgcgcgactacctgttgttgcgcggcctgctg
gggacctcgatcctgtggttcgagttggaccgcgacggtaacggcggcccgctgccggcc
gagcggtggcgggagtactgcctgtcctcggtcaccacccacgacctgccgccgaccgcc
ggctatctggccgccgaccatgtccggctgcgcgattcgctgggcctgctgacccggccg
gtggccgacgagctggagtccgaccgcgccgacctggcggcgtggatggccgagctgcgc
cgggtggggctgctcgcggacggcgaaaccgactcggagcaagtcattttggcgctctac
cgctatctgggccggacgccgtcgcggctgctgggtgtggcgctgaccgacgccgtgggc
gaccgccgcacccagaaccagcccggcaccaccgacgagtaccccaactggcgcgttccg
ctgaccggtccggacgggcggccggtgctgctggaagacgtgttcaccgatcgccgggcc
gccgccctggccgaggcggtgcgcgccgccatcgcgccgtga

DBGET integrated database retrieval system