KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1571Help
Entry
MAP1571           CDS       T00156                                 

Gene name
adhA_1
Definition
AdhA_1
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAP1571 (adhA_1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP1571 (adhA_1)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP1571 (adhA_1)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAP1571 (adhA_1)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAP1571 (adhA_1)
   00626 Naphthalene degradation
    MAP1571 (adhA_1)
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAP1571 (adhA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1724813..1725844
Genome map
AA seq 343 aa AA seqDB search
MMSSPVTTTAMRAWRVRRPGPMDTHPLEEVTTEVPRPGPSDLLVAVRACGVCRTDLHVTE
GDLPVHRDRVTPGHEVAGEVIEVGAEAGDEFGVGDRVGIAWLRHTCGVCKYCRRGDENLC
PESRYTGWDADGGYAEFATVPAAFAHPLPGGYSDSELAPLLCAGIIGYRALLRAQLPPGG
RLGLYGFGGSAHITAQVALAQGAEVHVMTRGDRARELAIELGAASAQGAADPPPVPLDAA
ILFAPVGDLVLPALAALDRGGTLAIAGIHLSDIPSLNYQRHLFQERQVRSVTSNTRADAR
AFLDFAGTHHISVTTPEYPLGQADRALADLSAGRIAGAAVLLV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcttctccggtgaccaccacggcgatgcgcgcctggagggtgcgtcggcccggt
ccgatggacactcatccgctcgaggaagtgaccaccgaggtgccgcgccccgggccgtcc
gacctgctggtcgcggtgcgtgcgtgcggcgtgtgccgcaccgatctgcatgtcaccgag
ggcgacctacccgtgcaccgcgaccgggtcacgcccggtcatgaggtggccggcgaggtc
atcgaagtcggcgccgaggccggcgacgagttcggcgtcggggaccgggtgggcatcgcc
tggctgcgccacacctgcggggtgtgcaaatactgccggcgcggcgacgagaacctgtgc
cccgagtcccgctacaccggctgggacgccgacggcggatacgccgaattcgcgaccgtg
ccagcggctttcgcgcacccactgcccggcggttatagcgacagcgagctcgcgccgctg
ctgtgtgcgggcatcatcggctaccgggcgctgctgcgcgcccagctaccgccgggcgga
cggttgggcctgtacggtttcggcggcagcgcgcacatcaccgcgcaggtcgccctggcg
cagggcgccgaggtgcacgtgatgacccgcggggaccgggcccgcgagctggcgatcgaa
ctcggcgccgcctccgcgcagggcgccgccgacccgccgcccgtcccgctggacgccgcc
atcctgttcgccccggtcggcgatctggtactgcccgcgctggcggcgctggaccgcggc
ggcaccctggcgatcgccggcattcacctgtccgacatcccgtcgctgaactaccagcgc
cacctgttccaggagcgccaggtgcgttcggtcacctccaacacccgggccgacgcgcgg
gccttcctcgacttcgcgggcacgcatcacatcagcgtcaccacgccggaatatcccctc
ggacaagcggatcgggcgctggcggatctgagcgccgggcgcatcgccggtgcggcggtg
ctgctggtctga

DBGET integrated database retrieval system