KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1613cHelp
Entry
MAP1613c          CDS       T00156                                 

Gene name
adhA_2
Definition
AdhA_2
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAP1613c (adhA_2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP1613c (adhA_2)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP1613c (adhA_2)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAP1613c (adhA_2)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAP1613c (adhA_2)
   00626 Naphthalene degradation
    MAP1613c (adhA_2)
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAP1613c (adhA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1767885..1768898)
Genome map
AA seq 337 aa AA seqDB search
MPTHQAVQIQSAGAALELVDTETRPPGRDEVRLTVGACGICGTDAHFVNGAFPGLSWPLT
PGHEIAGRIAELGEGVEGFAVGQRVAVGWFGGCCYRCDPCRAGLFIHCVNGKVPSWHYPG
GYAESVTVPTSALARIPEELTDAEAAPMGCAGVTTYNALRHTKALPGDRVAILGVGGLGH
LGVQFAAAMGFETIAINRGTGKADDARKLGAHHYIDSTAEDPAEALRALGGAAVVLATAG
NSQAMAATVGGLAPQGELVTIGVTPEPLPISPLQLITPGLSIVGHPSGTAKDVEDTMQFA
VLSGVRAWIEELPLSRAADGYAALEGGRAHYRTVLTM
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccaacacatcaagccgtccagattcaatccgccggcgcagcgttggaactggtcgac
accgaaacccggccgccgggccgggacgaggtacggctgacggtcggcgcctgcggcatc
tgcggcaccgacgctcacttcgtcaacggtgcattccccggcctgtcgtggccgttgacg
ccggggcatgaaatcgccggccggatcgccgagctgggcgagggtgtcgaagggttcgcg
gtcggccagcgggtcgcggtcggctggttcggcgggtgctgctaccggtgcgacccttgc
cgcgcaggccttttcatccactgcgtaaacgggaaggtacccagctggcactatcccggc
ggatacgcggaatcggtgacggtcccgaccagcgcgctggcccgcatccccgaggaactc
accgacgccgaagccgccccgatgggctgcgccggggtcaccacctacaacgctctgcgg
cacaccaaggcgctgcccggcgatcgggtggcgatcctgggggtcggcggcctgggtcat
ctcggcgtgcaattcgccgccgcaatgggtttcgagaccatcgcgatcaaccgcggtacc
ggtaaagccgatgacgcccggaaactgggcgcccatcactacatcgactccacggccgaa
gaccccgccgaagcgctgcgggcgttgggcggcgcggcggtggtgctggccaccgccggc
aattcgcaggccatggccgccacggtcggcggtcttgcgccgcagggcgagctggtcacc
atcggcgtcacgcccgagccgctgccgatcagtcccctgcagctgataacgccgggcctc
agcatcgtcggtcatccctccggcaccgccaaggacgtcgaggacaccatgcagttcgcg
gtcctgtccggggtgcgcgcctggatcgaggagctgccgttgtcccgggcggccgacggc
tacgccgccctggaaggcgggcgagcgcattaccgcaccgttttgaccatgtga

DBGET integrated database retrieval system