KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1877cHelp
Entry
MAP1877c          CDS       T00156                                 

Gene name
cysQ_1
Definition
CysQ_1
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mpa00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2074848..2075639)
Genome map
AA seq 263 aa AA seqDB search
MTPRNPSDEMTDAALATDLAAEAGELLLKVRDEVGFGYPWALGDAGDSLANALILGRLQA
ERPDDAVLSEEAYDDLSRLQHDRVWIIDPLDGTREFSTPGRDDWAVHVALWQRPTNGRRE
ITDAAVLPARGNIVYRSDTVTASAARVGVTDTIRIAVSATRPPAVLHRMRQRLPIQPVAI
GSAGAKAMAIIDGVVDAYLHAGGQWEWDSAAPAGVVMAAGMHASRLDGSPMRYNQLDPYL
PDFVMCRAELAPVLLGAIRDAWR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccccgcaacccgtcggacgagatgaccgacgccgcgctggccaccgatctcgcc
gccgaggcgggggaattgctgctgaaggtccgcgacgaggtcggcttcggctatccgtgg
gcgctcggcgacgcgggcgacagcctggcgaatgcgctgatcctgggacggttgcaggcc
gagcggccggacgatgccgtgctcagcgaggaggcctacgacgacctgtcccggctgcag
cacgaccgggtgtggatcatcgacccgctggacggcacgcgcgagttctccacgccgggc
cgcgacgactgggccgtgcatgtcgcgctgtggcagcgcccgaccaacggccggcgcgag
atcaccgacgccgcggtgttgccggcccgcggcaacatcgtctaccgcagcgacaccgtc
accgccagcgccgcgcgcgtcggcgtcaccgacaccatccgcatcgccgtcagcgccacc
cggccacccgctgttttgcaccggatgcgccagcggttgcccatccagcccgtcgcgatc
ggttcggccggcgccaaggcgatggcgatcatcgacggcgtggtcgacgcctatctgcac
gccgggggtcagtgggagtgggactcggccgccccggccggggtggtgatggccgccggg
atgcacgcatcgcggctggacggttcgccgatgcgctacaaccagctcgacccctacctg
ccggacttcgtcatgtgccgcgccgagctggcgcccgtgctgctgggcgcgatccgcgac
gcatggcgctag

DBGET integrated database retrieval system