KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1941Help
Entry
MAP1941           CDS       T00156                                 

Gene name
asnB_2
Definition
AsnB_2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MAP1941 (asnB_2)
Enzymes [BR:mpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MAP1941 (asnB_2)
Peptidases [BR:mpa01002]
 Cysteine Peptidases
  Family C44
   MAP1941 (asnB_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2142152..2144083
Genome map
AA seq 643 aa AA seqDB search
MCGLLAFVAARAGAVGADDAIARASHLMRHRGPDEPGTWAGADGSVVFGFNRLSIIDIAH
SHQPLRWGPPETPDRYELVFNGEIYNYLELRDELAARHGAVFATDGDGEAIVAGFHHWGT
DVLTRLRGMFAFALWDTVTRELFCARDPFGIKPLFVATGTGGTAVASEKKCLLELAELIG
FDTAIDERAVQHYTVLQYVPEPETLHRGVRRLESGCYARIRPGAAPDVTRYFVPRFAAVP
ITRDTEQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAIRHNPRLITFTT
GFEREGFSEIDVAVASAEAIGARHIAKVVHPDEFVAALPEIVWYLDEPVADPALVPLFFV
AREARKHVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPRPVRRSMGKVSRPLPDGMRG
KSLLHRGSLTLEERYYGNARSFSDTQLRDVLPGFRAEWTHTDVTAALYAQSIGWDPVARM
QHIDLFTWLRGDILVKADKMTMANSLELRVPFLDPEVFAVASRLPVEAKITRTTTKYALR
RALEPIVPAHVLHRPKLGFPVPIRHWLRAGELQDWAYSMVASSQAGHLVDLGAVRRMLDE
HRNGVSDHSRRLWTVLIFMLWHAIFVEHSVVPQISEPVYPVQL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggtctgctggcgttcgtcgccgcccgagccggtgccgtcggcgccgacgacgcg
atcgcgcgcgcctcgcacctgatgcgccaccgcgggcccgacgagccgggcacctgggcg
ggcgccgacggctccgtcgtgttcggcttcaaccggctgtcgatcatcgacatcgcccat
tcgcaccagccgctgcgctggggcccgcccgagacgccggaccgctacgagctggtgttc
aacggcgagatctacaactacctggagctgcgcgacgagctggccgcccgccacggcgcg
gtgttcgccaccgacggcgacggcgaggccatcgtcgccggcttccaccactggggcacc
gatgtgttgacccggctgcgcggcatgttcgcgtttgcgttgtgggacaccgtcactcgc
gaattgttctgtgcccgtgaccctttcggcatcaaaccgctgttcgtggcgaccggcacc
ggcggcaccgcggtggccagcgagaagaagtgcctgctggagctggccgagttgatcggg
ttcgacaccgcgatcgatgagcgcgcggtgcagcactacaccgtcctgcagtacgtgccg
gagcccgagacgctgcaccgcggggtgcgacggctggaatcgggctgttatgcccggatc
cggcccggcgcggcgcccgacgtcacccgctacttcgtgccccggttcgccgccgtgccc
atcacccgcgacaccgaacaggcccgctacgacgagatcaccgcggtgctcgaagattcg
gtggccaaacacatgcgcgccgacgtcaccgtcggggcgtttctgtccggcggcatcgac
tcgaccgccatcgcggcgctggccatccggcacaacccgcggctgatcaccttcaccacc
ggtttcgagcgcgagggattctccgagatcgacgtcgcggtggcctcggcggaggcgatc
ggcgcccggcacatcgccaaggtggtgcaccccgacgagttcgtcgccgccctgcccgag
atcgtctggtacctcgacgagccggtcgccgacccggcgctggtgccgttgttctttgtc
gcccgggaggcccgcaagcacgtcaaggtggtgctctccggtgagggcgccgacgagctg
ttcggcggctacacgatctaccgggaaccgttgtcgctgcggcctttcgactacctgccg
cggccggtgcggcgctcgatgggcaaggtgtccaggccgctgccggacgggatgcgcggc
aagagcctgctgcaccgcgggtcgctgacgctcgaggagcgctactacggcaacgcccgc
agcttctccgatacacagctgcgcgacgtgctgcccggcttccgcgcggaatggacgcac
accgacgtcaccgcggcgctgtacgcgcagtcgatcggctgggacccggtggcgcgcatg
cagcacatcgacctgttcacctggctgcgcggagacatcctggtcaaggccgacaagatg
acgatggccaactcgctggagctgcgggtgccgttcctggatcccgaggtgttcgccgtg
gcgtcccgattgccggtggaggccaagatcacccgcaccaccacgaagtacgcgttgcgg
cgggcgctggagccgatcgttcccgcgcacgtgctgcaccggcccaagctcggcttcccg
gtcccgatccggcattggctgcgcgccggcgagctgcaggactgggcctactcgatggtg
gcgtcgtctcaggccggtcacctggtggacctgggcgccgtgcgccggatgctcgacgag
caccgcaacggcgtcagcgatcacagccgccggctgtggacggtgctgatcttcatgctg
tggcacgccatcttcgtcgagcacagcgtggtgccgcagatcagcgagccggtgtacccg
gtgcagctctga

DBGET integrated database retrieval system