KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP1956Help
Entry
MAP1956           CDS       T00156                                 

Gene name
dlaT
Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mpa01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mpa00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mpa00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2159335..2161107
Genome map
AA seq 590 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVELDEPLVEVSTDKVDTEIPSPAAGVLTKII
AQEDDTVEVGGELAVIGDAADGAAGGGAQAPSQPSQPQAPAQPEPQAQEPAQAQPEAPAQ
PQAPAQPAPQESGGGAATPVLMPELGESVTEGTVTRWLKKVGDSVQVDDALVEVSTDKVD
TEIPSPVAGVLISITAEEDSTVPVGGELARIGTGAQAPAPAAPQPPPAPKPEPKPEPAPQ
PQAQPAPQPQAQPAPEPKAQPAQAQPAAGGEGTPYVTPLVRRLAAENDIDLSSITGTGVG
GRIRKQDVLAAAEQKQRQQQAAAQPSAAPAPAAAEARKPAAPTPAPALAHLRGTTQKASR
IRQITAAKTRESLLATAQLTQTHEVDMTRLVGLRARAKAAFAEREGVNLTFLPFIARAVI
DALKIHPNINASYNEETKEITYYDAEHLGFAVDTEQGLLSPVVHNAGDLSLAGLARAIAD
IAARARSGNLKPDELSGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPRVIVDE
FGNESIGVRSICYLPLTYDHRLIDGADAGRFLTTIKHRLEEGAFEADLGL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccggcactcggtgagagcgtcaccgaggggacggtcacc
cgctggctcaagcaggaaggggatacggtcgaactcgacgagccgctggtcgaggtgtcc
accgacaaggtcgacaccgagatcccgtcgcctgccgcgggtgtgctgaccaagatcatc
gcgcaggaagacgacaccgtggaggtgggcggcgaactggccgtgatcggcgacgcggcc
gacggcgccgccggcggcggggcgcaggcccccagccagccgagccagccccaagcaccg
gcccagcccgagcctcaggcccaggaaccggcccaggcccagcccgaggccccggcccag
ccgcaggcaccggcccagccggcgccacaggagtccggtggcggcgccgccaccccggtg
ctgatgcccgagctgggcgagtcggtgaccgagggcaccgtgacccgctggctcaagaag
gtcggggattcggtccaggtcgacgacgcgctggtcgaggtgtccaccgacaaggtcgac
accgagatcccgtcgccggtggccggcgtgctgatcagcatcacggccgaggaggacagc
accgtgccggtcggcggtgagctggcccgcatcggcaccggcgcccaggcgcccgccccc
gccgcgccccaacccccgccggcccccaagcccgaaccgaaacccgaaccggcaccccaa
ccccaggcgcagcccgcgccacagccacaagcccagccggcgcccgagccgaaagcccaa
ccggcgcaagcccagccggccgccggcggcgagggcaccccctacgtgacaccgctggtg
cgacggctggccgccgagaacgacatcgacctgtcctcgatcaccggcaccggggtgggc
ggtcgcatccgcaagcaagacgtcctggccgccgccgagcagaagcagcggcaacaacag
gccgccgcccagccgtcggccgcaccggcccccgcggccgccgaggcccgcaagcccgcc
gcgccgacgccggcgccggcgctggcgcacctgcgcggcaccacccagaaggccagccgg
atccgtcagatcaccgcggccaagacgcgcgaatccctgcttgccacagcccaactcacc
cagacccacgaggtcgacatgaccaggctggtcggattgcgggcccgggccaaggcggcg
ttcgccgagcgcgagggggtgaacctgacgttcctgccgttcatcgcccgcgcggtgatc
gacgcgctgaagatccaccccaacatcaacgccagttacaacgaggaaaccaaggagatc
acctactacgacgccgagcacctcggcttcgcggtcgacaccgaacaggggctgctgtcc
ccggtcgtgcacaacgccggcgacctgtcgctggccgggctggcccgggcgatcgccgac
atcgccgcgcgcgcccggtcgggcaacctcaagcccgacgagctatccggcggcaccttc
acgatcaccaacatcggcagccagggcgcgctgttcgacaccccgatcctggtcccgccg
caggccgccatgctgggcaccggggcgatcgtcaagcggccgcgggtgatcgtcgacgag
ttcggcaacgagtcgatcggcgtgcgctcgatctgctacctgccgctgacctacgaccac
cggctgatcgacggcgccgacgccggccgcttcctgaccaccatcaagcaccggctcgaa
gagggagcattcgaggccgacctcgggctgtga

DBGET integrated database retrieval system