KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2058cHelp
Entry
MAP2058c          CDS       T00156                                 

Gene name
cysQ_2
Definition
CysQ_2
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MAP2058c (cysQ_2)
Enzymes [BR:mpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MAP2058c (cysQ_2)
Transfer RNA biogenesis [BR:mpa03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MAP2058c (cysQ_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2266817..2267545)
Genome map
AA seq 242 aa AA seqDB search
MNDHELAARLATEAGRLLLGVRDEFADAPASERKAAGDKRSHDFLIEALAAERPGDAVLS
EEGADDPVRLRSERVWIVDPLDGTREFSELGRDDWAVHVALWEAGELVAGAVALPAQGVT
FATPEVASPPVAPGKPRIVVSRTRPPAIALNVRDALDGVLVEMGSAGAKVASVVQGLSDV
YVHAGGQFEWDSAAPVAVARAAGLHTSRIDGSTLAYNQPDPKLPDLVVCRPELADAVLAV
TR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccatgagctggccgcgcggttggccaccgaggccggtcggctgctgctgggg
gttcgagacgagttcgccgacgctccggcaagcgagcggaaagcggcgggggacaagcga
tcccacgattttctgatcgaggcgctggctgccgaacggcccggcgatgccgtgctgtcc
gaggagggcgccgacgacccggtgcgattgcgctccgagcgggtctggatcgtcgacccg
ctggacggcacgcgggagttctccgagctcggccgcgacgactgggcggtgcacgtcgcg
ctctgggaggccggcgagctggtggccggcgcggtggcactgccggcgcagggcgtcacg
ttcgcgacccccgaggtcgcgtcaccccccgtcgcgccgggcaagccgcgcatcgtggtg
tcgcgcacccgcccgcccgccatcgcgttgaacgtgcgggacgcgttggacggtgttctg
gtggaaatgggttcggccggcgccaaggtggcctcggtcgtccaggggctctccgacgtg
tacgtgcacgccggcggccagttcgaatgggactcggccgcgcccgttgcggtggcgcgg
gccgccggattgcacacgtcgcgcatcgacgggtcgacgctggcctacaaccaacccgac
ccgaagctgcccgatctggtggtctgccgtcccgagctggccgacgccgtcctcgcggtc
acccgctga

DBGET integrated database retrieval system