KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2251Help
Entry
MAP2251           CDS       T00156                                 

Gene name
rbsK
Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MAP2251 (rbsK)
Enzymes [BR:mpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MAP2251 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2515286..2516254
Genome map
AA seq 322 aa AA seqDB search
MTVCRDADPRQKARAPGLVWPPGRRLTSAPMTDVCVVGSVNLDLSLAVDALPRPGETVLA
SSLRQAPGGKGGNQAVAAARAGARVQFVGAVGDDAAAGQLRAHLQANGVGLDGAVEIPGP
SGTAIVVVDANAENTIVVAPGANGRFTLNDERARAVLAGCDVMLTQLEIPVATAVAAARH
ARSGGAVVVVNASPAGRDPDSLSELAAAADVVITNEEEASEWPWRPRHLVVTLGSHGARY
VGADGEYSVPSPDVDAVDTTGAGDVFAGVLAANWPLEPGSPDQRRLALRRACAAGALATL
VPGAGDCAPRAEEIERALRGKS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgtttgccgtgacgcggatccgcggcaaaaggcccgcgcccctggcctggtttgg
ccgccggggcggcgactaacctcggcgcccatgacagacgtctgtgtggtgggcagtgtg
aacctcgatctgtcgctggccgtcgacgcgctgccgcggcccggcgagacggtgctggcg
tcgtcgttgcggcaggcccccggcggcaaggggggcaaccaggcggtggcggcggcgcgg
gcgggcgcgcgggtgcagttcgtcggcgcggtcggcgacgacgcggccgccgggcagttg
cgggcgcacctgcaggccaacggggtcgggctggacggggccgtcgagatccccgggccc
agcggcaccgcgatcgtggtcgtcgacgccaacgccgagaacaccatcgtggtcgccccg
ggcgccaacgggcggttcacgctgaacgacgagcgtgcccgcgcggtgctcgcgggctgc
gacgtgatgctcacccagctcgagattcctgtcgccaccgcggtcgcggcggcgcggcac
gcccggtccggcggagcggtggtcgtggtgaacgcgtcgccggcaggccgggaccccgac
tcgttgagcgagctggccgccgccgccgacgtggtgatcaccaacgaggaggaggccagc
gaatggccttggcggccaaggcacttggtggtcaccctgggatcgcacggtgcccgttac
gtcggcgccgacggcgagtactcggtgccctcccccgacgtcgatgcggtggacaccaca
ggtgccggcgacgtgttcgccggggtgctggcggcgaactggccactcgagcccggttcg
ccggatcagcggcggctggcgttgcgacgggcctgcgccgcgggtgcgctggccaccctg
gtgcccggggccggggattgcgcgccgcgggccgaggaaatcgaaagggccttgcgtggt
aagtcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system