KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2467cHelp
Entry
MAP2467c          CDS       T00156                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MAP2467c (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAP2467c (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MAP2467c (thrC)
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MAP2467c (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2771217..2772299)
Genome map
AA seq 360 aa AA seqDB search
MSAQRTAVHQPWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIPARRLSEKTGCTVHLKVE
GLNPTGSFKDRGMTMAVTDALARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEI
VDVLGAAPDVHALPVGNAGNITAYWKGYTEYHHEGLIEKLPRMLGTQAAGAAPLVHGEPV
KNPETIATAIRIGAPASWTAAVDAQQQSHGRFLAATDDEILAAYHLVAESEGVFVEPASA
ASIAGLLKAVEDGWVARGSTVVCTVTGNGLKDPDTALRDMPAVTPLPVDPVLVVEKLGLA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccagcgcaccgccgtccatcagccctggcccggcctcatcgaggcctaccga
gaccggctgccggtgggcgacgactggaccccggtgaccctgctcgagggcggcaccccg
ctgatcccggcccgccggctctcggaaaagaccggctgcacagtccatctcaaggtcgag
ggcctcaaccccaccggctccttcaaggaccgcggcatgacgatggcggtcaccgacgcg
ctggcgcgcggccagcaggcggtgctgtgtgcctccaccggcaacacctcggcgtcggcg
gcggcctatgcggcccgtgccggcatcacctgcgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctcgcgcaggcggtcatgcacggcgccaagatcattcagatcgacggc
aacttcgacgactgcctggaactggcccgcaagatggccgccgacttcccgacgatctcg
ttggtcaattcggtcaacccggtgcgcatcgagggtcagaagaccgcggcgttcgagatc
gtcgatgtgctgggcgccgcgcctgacgtgcacgcgcttccggtcggcaacgccggcaac
atcaccgcgtactggaagggatacaccgagtatcaccacgagggcctgatcgagaagctg
ccccgcatgctcggcacccaggccgccggggcggccccgctcgtgcacggcgagccggtc
aaaaaccccgagaccatcgcgaccgcgatccgcatcggcgcgccggcatcgtggaccgcg
gccgtcgacgcgcagcagcaatcccacggccgcttcctggcggccaccgacgacgagatc
ctggccgcctatcatctggtcgccgagtccgagggcgtgttcgtcgaacccgcgtcggcc
gccagcatcgcgggactgctgaaggcggtcgaggacggctgggtggcgcgcgggtcgacg
gtggtgtgcacggtgaccggcaacggcctgaaggatccggacaccgcgctgcgggacatg
ccggccgtgacgccgctgccggtcgacccggtcctggtggtcgagaagctcgggctggcc
tga

DBGET integrated database retrieval system