KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2852Help
Entry
MAP2852           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP2852
Enzymes [BR:mpa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     MAP2852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3181011..3181442
Genome map
AA seq 143 aa AA seqDB search
MTELTGTTVANTRTVEGFLNALQDADYDAAEAALADDLVYENVGLPTIHGRARAMKLFRR
MEDRAAFEVKIHRIAADGGAVLTERTDALIFGPLRLQFWVCGVFEVQNGRITLWRDYFDF
FDMLKATARGVAALLLPSLKATF
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctgactgggaccaccgttgcgaacacccgtacggtcgaaggattcctcaac
gcgctgcaggacgcggattacgacgccgccgaggccgcactggccgacgacctcgtctac
gagaacgtcgggctgcccaccatccacggccgggcccgggccatgaagctgtttcgccgg
atggaggaccgcgccgccttcgaggtgaagatccaccgcatcgcggccgacggcggcgcg
gtgctcaccgaacgcaccgatgcgctgatcttcggcccgctgcggctgcagttctgggtg
tgcggcgtgttcgaggtgcagaacgggcgaatcacgttgtggcgggactacttcgacttc
ttcgacatgctcaaggccacggcgcgcggggtggccgcgctgctgctgccgtcgctgaaa
gccacgttctga

DBGET integrated database retrieval system